Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA-directed RNA polymerases I and III subunit RPAC1

Gene

POLR1C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • DNA binding Source: InterPro
  • DNA-directed 5'-3' RNA polymerase activity Source: ProtInc
  • protein dimerization activity Source: InterPro

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTranscription

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1834949 Cytosolic sensors of pathogen-associated DNA
R-HSA-427413 NoRC negatively regulates rRNA expression
R-HSA-5250924 B-WICH complex positively regulates rRNA expression
R-HSA-73762 RNA Polymerase I Transcription Initiation
R-HSA-73772 RNA Polymerase I Promoter Escape
R-HSA-73777 RNA Polymerase I Chain Elongation
R-HSA-73780 RNA Polymerase III Chain Elongation
R-HSA-73863 RNA Polymerase I Transcription Termination
R-HSA-73980 RNA Polymerase III Transcription Termination
R-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation
R-HSA-76061 RNA Polymerase III Transcription Initiation From Type 1 Promoter
R-HSA-76066 RNA Polymerase III Transcription Initiation From Type 2 Promoter
R-HSA-76071 RNA Polymerase III Transcription Initiation From Type 3 Promoter

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA-directed RNA polymerases I and III subunit RPAC1
Short name:
DNA-directed RNA polymerase I subunit C
Short name:
RNA polymerases I and III subunit AC1
Alternative name(s):
AC40
DNA-directed RNA polymerases I and III 40 kDa polypeptide
Short name:
RPA40
RPA39
RPC40
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:POLR1C
Synonyms:POLR1E
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000171453.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20194 POLR1C

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610060 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15160

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

DNA-directed RNA polymerase, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Treacher Collins syndrome 3 (TCS3)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of Treacher Collins syndrome, a disorder of craniofacial development. Treacher Collins syndrome is characterized by a combination of bilateral downward slanting of the palpebral fissures, colobomas of the lower eyelids with a paucity of eyelashes medial to the defect, hypoplasia of the facial bones, cleft palate, malformation of the external ears, atresia of the external auditory canals, and bilateral conductive hearing loss.
See also OMIM:248390
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_064899279R → Q in TCS3; no effect on localization to the nucleus; no effect on association with RNA polymerase I and RNA polymerase III complexes. 2 PublicationsCorresponds to variant dbSNP:rs191582628EnsemblClinVar.1
Natural variantiVAR_064900279R → W in TCS3. 1 PublicationCorresponds to variant dbSNP:rs141156009EnsemblClinVar.1
Leukodystrophy, hypomyelinating, 11 (HLD11)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive neurologic disorder characterized by brain hypomyelination, delayed psychomotor development, intellectual disability, tremor and other neurologic symptoms. Some patients may additionally manifest non-neurologic features, particularly dental abnormalities and hypogonadotropic hypogonadism.
See also OMIM:616494
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07465526T → I in HLD11. 1 PublicationCorresponds to variant dbSNP:rs796052126EnsemblClinVar.1
Natural variantiVAR_07465632N → I in HLD11; decreased localization to the nucleus and retained in the cytoplasm; loss of association with RNA polymerase III-transcribed genes; decreased association with RNA polymerase III complex; probably prevents RNA polymerase III complex assembly and activity. 1 PublicationCorresponds to variant dbSNP:rs796052124EnsemblClinVar.1
Natural variantiVAR_07465765M → V in HLD11. 1 PublicationCorresponds to variant dbSNP:rs141471029EnsemblClinVar.1
Natural variantiVAR_07465874N → S in HLD11; decreased localization to the nucleus and retained in the cytoplasm; loss of association with RNA polymerase III-transcribed genes; decreased association with RNA polymerase III complex; probably prevents RNA polymerase III complex assembly and activity. 1 PublicationCorresponds to variant dbSNP:rs371802902EnsemblClinVar.1
Natural variantiVAR_07465994V → A in HLD11. 1 Publication1
Natural variantiVAR_074660109R → H in HLD11. 1 PublicationCorresponds to variant dbSNP:rs796052127EnsemblClinVar.1
Natural variantiVAR_074661132G → D in HLD11. 1 PublicationCorresponds to variant dbSNP:rs201320592Ensembl.1
Natural variantiVAR_074662146C → R in HLD11. 1 PublicationCorresponds to variant dbSNP:rs796052125EnsemblClinVar.1
Natural variantiVAR_074663191R → Q in HLD11. 1 PublicationCorresponds to variant dbSNP:rs373046018EnsemblClinVar.1
Natural variantiVAR_074664262I → T in HLD11. 1 PublicationCorresponds to variant dbSNP:rs751006626Ensembl.1
Natural variantiVAR_074665295Missing in HLD11. 1 Publication1
Natural variantiVAR_074666324E → K in HLD11. 1 Publication1

Keywords - Diseasei

Disease mutation, Leukodystrophy

Organism-specific databases

DisGeNET

More...
DisGeNETi
9533

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
POLR1C

MalaCards human disease database

More...
MalaCardsi
POLR1C
MIMi248390 phenotype
616494 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000171453

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
88637 Hypomyelination-hypogonadotropic hypogonadism-hypodontia syndrome
861 Treacher-Collins syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134882004

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
POLR1C

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001327392 – 346DNA-directed RNA polymerases I and III subunit RPAC1Add BLAST345

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei4PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O15160

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O15160

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O15160

PeptideAtlas

More...
PeptideAtlasi
O15160

PRoteomics IDEntifications database

More...
PRIDEi
O15160

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48481
48482 [O15160-2]

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00217386

Two-dimensional polyacrylamide gel electrophoresis database from the Geneva University Hospital

More...
SWISS-2DPAGEi
O15160

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15160

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15160

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000171453 Expressed in 221 organ(s), highest expression level in secondary oocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_POLR1C
HS_POLR1E

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O15160 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15160 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA031010

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the RNA polymerase I (Pol I) and RNA polymerase III (Pol III) complexes consisting of at least 13 and 17 subunits, respectively.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114909, 114 interactors

Database of interacting proteins

More...
DIPi
DIP-27587N

Protein interaction database and analysis system

More...
IntActi
O15160, 130 interactors

Molecular INTeraction database

More...
MINTi
O15160

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000361465

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O15160

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O15160

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1521 Eukaryota
COG0202 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153546

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230845

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG017743

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15160

KEGG Orthology (KO)

More...
KOi
K03027

Identification of Orthologs from Complete Genome Data

More...
OMAi
RGKDHAK

Database of Orthologous Groups

More...
OrthoDBi
EOG091G03FZ

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O15160

TreeFam database of animal gene trees

More...
TreeFami
TF103034

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07032 RNAP_I_II_AC40, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.170.120.12, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001514 DNA-dir_RNA_pol_30-40kDasu_CS
IPR011262 DNA-dir_RNA_pol_insert
IPR011263 DNA-dir_RNA_pol_RpoA/D/Rpb3
IPR036603 RBP11-like
IPR033901 RNAPI/II_AC40
IPR036643 RNApol_insert_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11800:SF13 PTHR11800:SF13, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01000 RNA_pol_A_bac, 1 hit
PF01193 RNA_pol_L, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00662 RPOLD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55257 SSF55257, 1 hit
SSF56553 SSF56553, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00446 RNA_POL_D_30KD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15160-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAASQAVEEM RSRVVLGEFG VRNVHTTDFP GNYSGYDDAW DQDRFEKNFR
60 70 80 90 100
VDVVHMDENS LEFDMVGIDA AIANAFRRIL LAEVPTMAVE KVLVYNNTSI
110 120 130 140 150
VQDEILAHRL GLIPIHADPR LFEYRNQGDE EGTEIDTLQF RLQVRCTRNP
160 170 180 190 200
HAAKDSSDPN ELYVNHKVYT RHMTWIPLGN QADLFPEGTI RPVHDDILIA
210 220 230 240 250
QLRPGQEIDL LMHCVKGIGK DHAKFSPVAT ASYRLLPDIT LLEPVEGEAA
260 270 280 290 300
EELSRCFSPG VIEVQEVQGK KVARVANPRL DTFSREIFRN EKLKKVVRLA
310 320 330 340
RVRDHYIFSV ESTGVLPPDV LVSEAIKVLM GKCRRFLDEL DAVQMD
Length:346
Mass (Da):39,250
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB7D558BC8F33D92E
GO
Isoform 2 (identifier: O15160-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     308-346: FSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD → CKKDLLAAVAHTCNPSTLGGQGEWITGSRERDHPG

Note: No experimental confirmation available.
Show »
Length:342
Mass (Da):38,647
Checksum:i9E2785123BB74D8B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RDJ3D6RDJ3_HUMAN
DNA-directed RNA polymerases I and ...
POLR1C
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EQB9E7EQB9_HUMAN
DNA-directed RNA polymerases I and ...
POLR1C
296Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y723H0Y723_HUMAN
DNA-directed RNA polymerases I and ...
POLR1C
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YEZ4A0A2R8YEZ4_HUMAN
DNA-directed RNA polymerases I and ...
POLR1C
307Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y5D3A0A2R8Y5D3_HUMAN
DNA-directed RNA polymerases I and ...
POLR1C
343Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YEY5A0A2R8YEY5_HUMAN
DNA-directed RNA polymerases I and ...
POLR1C
291Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y8D6A0A2R8Y8D6_HUMAN
DNA-directed RNA polymerases I and ...
POLR1C
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07465526T → I in HLD11. 1 PublicationCorresponds to variant dbSNP:rs796052126EnsemblClinVar.1
Natural variantiVAR_07465632N → I in HLD11; decreased localization to the nucleus and retained in the cytoplasm; loss of association with RNA polymerase III-transcribed genes; decreased association with RNA polymerase III complex; probably prevents RNA polymerase III complex assembly and activity. 1 PublicationCorresponds to variant dbSNP:rs796052124EnsemblClinVar.1
Natural variantiVAR_07465765M → V in HLD11. 1 PublicationCorresponds to variant dbSNP:rs141471029EnsemblClinVar.1
Natural variantiVAR_07465874N → S in HLD11; decreased localization to the nucleus and retained in the cytoplasm; loss of association with RNA polymerase III-transcribed genes; decreased association with RNA polymerase III complex; probably prevents RNA polymerase III complex assembly and activity. 1 PublicationCorresponds to variant dbSNP:rs371802902EnsemblClinVar.1
Natural variantiVAR_07465994V → A in HLD11. 1 Publication1
Natural variantiVAR_074660109R → H in HLD11. 1 PublicationCorresponds to variant dbSNP:rs796052127EnsemblClinVar.1
Natural variantiVAR_074661132G → D in HLD11. 1 PublicationCorresponds to variant dbSNP:rs201320592Ensembl.1
Natural variantiVAR_074662146C → R in HLD11. 1 PublicationCorresponds to variant dbSNP:rs796052125EnsemblClinVar.1
Natural variantiVAR_074663191R → Q in HLD11. 1 PublicationCorresponds to variant dbSNP:rs373046018EnsemblClinVar.1
Natural variantiVAR_074664262I → T in HLD11. 1 PublicationCorresponds to variant dbSNP:rs751006626Ensembl.1
Natural variantiVAR_064899279R → Q in TCS3; no effect on localization to the nucleus; no effect on association with RNA polymerase I and RNA polymerase III complexes. 2 PublicationsCorresponds to variant dbSNP:rs191582628EnsemblClinVar.1
Natural variantiVAR_064900279R → W in TCS3. 1 PublicationCorresponds to variant dbSNP:rs141156009EnsemblClinVar.1
Natural variantiVAR_074665295Missing in HLD11. 1 Publication1
Natural variantiVAR_074666324E → K in HLD11. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005913308 – 346FSVES…AVQMD → CKKDLLAAVAHTCNPSTLGG QGEWITGSRERDHPG in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF008442 mRNA Translation: AAC14354.1
AF047441 mRNA Translation: AAC39892.1
AL355802 Genomic DNA No translation available.
BC008863 mRNA Translation: AAH08863.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4900.1 [O15160-2]
CCDS4901.1 [O15160-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001305805.1, NM_001318876.1 [O15160-2]
NP_976035.1, NM_203290.3 [O15160-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.743509

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000304004; ENSP00000307212; ENSG00000171453 [O15160-2]
ENST00000372389; ENSP00000361465; ENSG00000171453 [O15160-1]
ENST00000607635; ENSP00000496683; ENSG00000171453 [O15160-2]
ENST00000642195; ENSP00000496044; ENSG00000171453 [O15160-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9533

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9533

UCSC genome browser

More...
UCSCi
uc003ovn.4 human [O15160-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF008442 mRNA Translation: AAC14354.1
AF047441 mRNA Translation: AAC39892.1
AL355802 Genomic DNA No translation available.
BC008863 mRNA Translation: AAH08863.1
CCDSiCCDS4900.1 [O15160-2]
CCDS4901.1 [O15160-1]
RefSeqiNP_001305805.1, NM_001318876.1 [O15160-2]
NP_976035.1, NM_203290.3 [O15160-1]
UniGeneiHs.743509

3D structure databases

ProteinModelPortaliO15160
SMRiO15160
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114909, 114 interactors
DIPiDIP-27587N
IntActiO15160, 130 interactors
MINTiO15160
STRINGi9606.ENSP00000361465

PTM databases

iPTMnetiO15160
PhosphoSitePlusiO15160

Polymorphism and mutation databases

BioMutaiPOLR1C

2D gel databases

REPRODUCTION-2DPAGEiIPI00217386
SWISS-2DPAGEiO15160

Proteomic databases

EPDiO15160
MaxQBiO15160
PaxDbiO15160
PeptideAtlasiO15160
PRIDEiO15160
ProteomicsDBi48481
48482 [O15160-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9533
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304004; ENSP00000307212; ENSG00000171453 [O15160-2]
ENST00000372389; ENSP00000361465; ENSG00000171453 [O15160-1]
ENST00000607635; ENSP00000496683; ENSG00000171453 [O15160-2]
ENST00000642195; ENSP00000496044; ENSG00000171453 [O15160-1]
GeneIDi9533
KEGGihsa:9533
UCSCiuc003ovn.4 human [O15160-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9533
DisGeNETi9533
EuPathDBiHostDB:ENSG00000171453.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
POLR1C
GeneReviewsiPOLR1C

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0005907
HGNCiHGNC:20194 POLR1C
HPAiHPA031010
MalaCardsiPOLR1C
MIMi248390 phenotype
610060 gene
616494 phenotype
neXtProtiNX_O15160
OpenTargetsiENSG00000171453
Orphaneti88637 Hypomyelination-hypogonadotropic hypogonadism-hypodontia syndrome
861 Treacher-Collins syndrome
PharmGKBiPA134882004

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1521 Eukaryota
COG0202 LUCA
GeneTreeiENSGT00940000153546
HOGENOMiHOG000230845
HOVERGENiHBG017743
InParanoidiO15160
KOiK03027
OMAiRGKDHAK
OrthoDBiEOG091G03FZ
PhylomeDBiO15160
TreeFamiTF103034

Enzyme and pathway databases

ReactomeiR-HSA-1834949 Cytosolic sensors of pathogen-associated DNA
R-HSA-427413 NoRC negatively regulates rRNA expression
R-HSA-5250924 B-WICH complex positively regulates rRNA expression
R-HSA-73762 RNA Polymerase I Transcription Initiation
R-HSA-73772 RNA Polymerase I Promoter Escape
R-HSA-73777 RNA Polymerase I Chain Elongation
R-HSA-73780 RNA Polymerase III Chain Elongation
R-HSA-73863 RNA Polymerase I Transcription Termination
R-HSA-73980 RNA Polymerase III Transcription Termination
R-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation
R-HSA-76061 RNA Polymerase III Transcription Initiation From Type 1 Promoter
R-HSA-76066 RNA Polymerase III Transcription Initiation From Type 2 Promoter
R-HSA-76071 RNA Polymerase III Transcription Initiation From Type 3 Promoter

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
POLR1C

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9533

Protein Ontology

More...
PROi
PR:O15160

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000171453 Expressed in 221 organ(s), highest expression level in secondary oocyte
CleanExiHS_POLR1C
HS_POLR1E
ExpressionAtlasiO15160 baseline and differential
GenevisibleiO15160 HS

Family and domain databases

CDDicd07032 RNAP_I_II_AC40, 1 hit
Gene3Di2.170.120.12, 1 hit
InterProiView protein in InterPro
IPR001514 DNA-dir_RNA_pol_30-40kDasu_CS
IPR011262 DNA-dir_RNA_pol_insert
IPR011263 DNA-dir_RNA_pol_RpoA/D/Rpb3
IPR036603 RBP11-like
IPR033901 RNAPI/II_AC40
IPR036643 RNApol_insert_sf
PANTHERiPTHR11800:SF13 PTHR11800:SF13, 1 hit
PfamiView protein in Pfam
PF01000 RNA_pol_A_bac, 1 hit
PF01193 RNA_pol_L, 1 hit
SMARTiView protein in SMART
SM00662 RPOLD, 1 hit
SUPFAMiSSF55257 SSF55257, 1 hit
SSF56553 SSF56553, 1 hit
PROSITEiView protein in PROSITE
PS00446 RNA_POL_D_30KD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRPAC1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15160
Secondary accession number(s): O75395, Q5JTE3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: January 1, 1998
Last modified: December 5, 2018
This is version 194 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again