Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O15156 (ZBT7B_HUMAN)

Entry version 183 (07 Apr 2021)
Sequence version 2 (16 Aug 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc finger and BTB domain-containing protein 7B

Gene

ZBTB7B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. Exerts distinct biological functions in the mammary epithelial cells and T cells in a tissue-specific manner. Necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. Development of immature T-cell precursors (thymocytes) to either the CD4 helper or CD8 killer T-cell lineages correlates precisely with their T-cell receptor specificity for major histocompatibility complex class II or class I molecules, respectively. Cross-antagonism between ZBTB7B and CBF complexes are determinative to CD4 versus CD8 cell fate decision. Suppresses RUNX3 expression and imposes CD4+ lineage fate by inducing the SOCS suppressors of cytokine signaling. induces, as a transcriptional activator, SOCS genes expression which represses RUNX3 expression and promotes the CD4+ lineage fate. During CD4 lineage commitment, associates with multiple sites at the CD8 locus, acting as a negative regulator of the CD8 promoter and enhancers by epigenetic silencing through the recruitment of class II histone deacetylases, such as HDAC4 and HDAC5, to these loci. Regulates the development of IL17-producing CD1d-restricted naural killer (NK) T cells. Also functions as an important metabolic regulator in the lactating mammary glands. Critical feed-forward regulator of insulin signaling in mammary gland lactation, directly regulates expression of insulin receptor substrate-1 (IRS-1) and insulin-induced Akt-mTOR-SREBP signaling (By similarity). Transcriptional repressor of the collagen COL1A1 and COL1A2 genes. May also function as a repressor of fibronectin and possibly other extracellular matrix genes (PubMed:9370309). Potent driver of brown fat development, thermogenesis and cold-induced beige fat formation. Recruits the brown fat lncRNA 1 (Blnc1):HNRNPU ribonucleoprotein complex to activate thermogenic gene expression in brown and beige adipocytes (By similarity).By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri346 – 368C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri374 – 396C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri402 – 424C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri430 – 454C2H2-type 4; atypicalPROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, DNA-binding, Repressor
Biological processDifferentiation, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O15156

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger and BTB domain-containing protein 7BCurated
Alternative name(s):
Krueppel-related zinc finger protein cKrox
Short name:
hcKrox
T-helper-inducing POZ/Krueppel-like factor
Zinc finger and BTB domain-containing protein 15
Zinc finger protein 67 homolog
Short name:
Zfp-67
Zinc finger protein 857B
Zinc finger protein Th-POK
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZBTB7BImported
Synonyms:ZBTB15, ZFP67, ZNF857B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:18668, ZBTB7B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		607646, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O15156

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000160685.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		51043

Open Targets

More...OpenTargetsi		ENSG00000160685

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA38630

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O15156, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ZBTB7B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000477191 – 539Zinc finger and BTB domain-containing protein 7BAdd BLAST539

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei150PhosphoserineCombined sources1
Modified residuei206N6-acetyllysine; by EP300; alternateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki206Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei212N6-acetyllysine; by EP300; alternateBy similarity1
Cross-linki212Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei335N6-acetyllysine; by EP300; alternateBy similarity1
Cross-linki335Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei369PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Acetylated directly and specifically by EP300 (PubMed:20810990). EP300-mediated acetylation of Lys-206, Lys-212 and Lys-335 stabilizes the protein by antagonizing ubiquitin conjugation (By similarity).By similarity1 Publication
Ubiquitinated, leading to proteasomal degradation (PubMed:20810990). Competes with acetylation on Lys-206, Lys-212 and Lys-335 (By similarity).By similarity1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O15156

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O15156

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O15156

MaxQB - The MaxQuant DataBase

More...MaxQBi		O15156

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O15156

PeptideAtlas

More...PeptideAtlasi		O15156

PRoteomics IDEntifications database

More...PRIDEi		O15156

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		48480 [O15156-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O15156

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O15156

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000160685, Expressed in esophagus mucosa and 201 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O15156, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000160685, Tissue enhanced (intestine)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimerizes.

Interacts with NCL, NEDD4 and YBX1.

Interacts with HNRNPU (via RNA-binding RGG-box region); the interaction facilitates the recruitment of long non-coding RNA Blnc1 by ZBTB7B.

Interacts with HDAC4 and HDAC5; the interaction allows the recruitment of HDAC4 and HDAC5 on CD8 loci for deacetylation and possible inhibition of CD8 genes expression.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		119242, 60 interactors

Protein interaction database and analysis system

More...IntActi		O15156, 27 interactors

Molecular INTeraction database

More...MINTi		O15156

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000406286

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O15156, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O15156

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini34 – 115BTBPROSITE-ProRule annotationAdd BLAST82

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni344 – 400Required for interaction with and acetylation by EP300By similarityAdd BLAST57

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi181 – 196Pro-richAdd BLAST16

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri346 – 368C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri374 – 396C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri402 – 424C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri430 – 454C2H2-type 4; atypicalPROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1721, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160219

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_025627_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O15156

Identification of Orthologs from Complete Genome Data

More...OMAi		PNGDDSP

Database of Orthologous Groups

More...OrthoDBi		1318335at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O15156

TreeFam database of animal gene trees

More...TreeFami		TF331824

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000210, BTB/POZ_dom
IPR011333, SKP1/BTB/POZ_sf
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00651, BTB, 1 hit
PF00096, zf-C2H2, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00225, BTB, 1 hit
SM00355, ZnF_C2H2, 4 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54695, SSF54695, 1 hit
SSF57667, SSF57667, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50097, BTB, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 3 hits
PS50157, ZINC_FINGER_C2H2_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O15156-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSPEDDLIG IPFPDHSSEL LSCLNEQRQL GHLCDLTIRT QGLEYRTHRA 
        60         70         80         90        100
VLAACSHYFK KLFTEGGGGA VMGAGGSGTA TGGAGAGVCE LDFVGPEALG 
       110        120        130        140        150
ALLEFAYTAT LTTSSANMPA VLQAARLLEI PCVIAACMEI LQGSGLEAPS 
       160        170        180        190        200
PDEDDCERAR QYLEAFATAT ASGVPNGEDS PPQVPLPPPP PPPPRPVARR 
       210        220        230        240        250
SRKPRKAFLQ TKGARANHLV PEVPTVPAHP LTYEEEEVAG RVGSSGGSGP 
       260        270        280        290        300
GDSYSPPTGT ASPPEGPQSY EPYEGEEEEE ELVYPPAYGL AQGGGPPLSP 
       310        320        330        340        350
EELGSDEDAI DPDLMAYLSS LHQDNLAPGL DSQDKLVRKR RSQMPQECPV 
       360        370        380        390        400
CHKIIHGAGK LPRHMRTHTG EKPFACEVCG VRFTRNDKLK IHMRKHTGER 
       410        420        430        440        450
PYSCPHCPAR FLHSYDLKNH MHLHTGDRPY ECHLCHKAFA KEDHLQRHLK 
       460        470        480        490        500
GQNCLEVRTR RRRKDDAPPH YPPPSTAAAS PAGLDLSNGH LDTFRLSLAR 
       510        520        530 
FWEQSAPTGP PVSTPGPPDD DEEEGAPTTP QAEGAMESS
Length:539
Mass (Da):58,027
Last modified:August 16, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i86B3616504B05B7E
GO
Isoform 2 (identifier: O15156-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLQPGPHPPSPQAAAPGEAWPGPSQAPWQSLEEKM

Show »
Length:573
Mass (Da):61,584
Checksum:iF85D79769C9BE294
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti90E → K in BAG65517 (PubMed:14702039).Curated1
Sequence conflicti235E → G in BAG65517 (PubMed:14702039).Curated1
Sequence conflicti437K → R in AAC51847 (PubMed:9370309).Curated1
Sequence conflicti480S → F in AAC51847 (PubMed:9370309).Curated1
Sequence conflicti509 – 510GP → WA in AAC51847 (PubMed:9370309).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0447211M → MLQPGPHPPSPQAAAPGEAW PGPSQAPWQSLEEKM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF007833 mRNA Translation: AAC51847.1
AK304762 mRNA Translation: BAG65517.1
CR749303 mRNA Translation: CAH18158.1
AL451085 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53149.1
CH471121 Genomic DNA Translation: EAW53150.1
CH471121 Genomic DNA Translation: EAW53151.1
BC012070 mRNA Translation: AAH12070.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1081.1 [O15156-1]
CCDS58030.1 [O15156-2]

NCBI Reference Sequences

More...RefSeqi		NP_001239335.1, NM_001252406.2 [O15156-2]
NP_001243384.1, NM_001256455.1 [O15156-1]
XP_006711412.2, XM_006711349.2
XP_006711416.1, XM_006711353.1
XP_006711417.1, XM_006711354.1 [O15156-1]
XP_006711419.1, XM_006711356.3 [O15156-1]
XP_006711420.1, XM_006711357.1 [O15156-1]
XP_006711421.1, XM_006711358.1 [O15156-1]
XP_006711422.1, XM_006711359.2 [O15156-1]
XP_011507900.1, XM_011509598.2 [O15156-2]
XP_011507901.1, XM_011509599.2 [O15156-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000292176; ENSP00000292176; ENSG00000160685 [O15156-1]
ENST00000368426; ENSP00000357411; ENSG00000160685 [O15156-1]
ENST00000417934; ENSP00000406286; ENSG00000160685 [O15156-2]
ENST00000535420; ENSP00000438647; ENSG00000160685 [O15156-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		51043

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:51043

UCSC genome browser

More...UCSCi		uc001fgk.5, human [O15156-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007833 mRNA Translation: AAC51847.1
AK304762 mRNA Translation: BAG65517.1
CR749303 mRNA Translation: CAH18158.1
AL451085 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53149.1
CH471121 Genomic DNA Translation: EAW53150.1
CH471121 Genomic DNA Translation: EAW53151.1
BC012070 mRNA Translation: AAH12070.1
CCDSiCCDS1081.1 [O15156-1]
CCDS58030.1 [O15156-2]
RefSeqiNP_001239335.1, NM_001252406.2 [O15156-2]
NP_001243384.1, NM_001256455.1 [O15156-1]
XP_006711412.2, XM_006711349.2
XP_006711416.1, XM_006711353.1
XP_006711417.1, XM_006711354.1 [O15156-1]
XP_006711419.1, XM_006711356.3 [O15156-1]
XP_006711420.1, XM_006711357.1 [O15156-1]
XP_006711421.1, XM_006711358.1 [O15156-1]
XP_006711422.1, XM_006711359.2 [O15156-1]
XP_011507900.1, XM_011509598.2 [O15156-2]
XP_011507901.1, XM_011509599.2 [O15156-1]

3D structure databases

SMRiO15156
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi119242, 60 interactors
IntActiO15156, 27 interactors
MINTiO15156
STRINGi9606.ENSP00000406286

PTM databases

iPTMnetiO15156
PhosphoSitePlusiO15156

Genetic variation databases

BioMutaiZBTB7B

Proteomic databases

EPDiO15156
jPOSTiO15156
MassIVEiO15156
MaxQBiO15156
PaxDbiO15156
PeptideAtlasiO15156
PRIDEiO15156
ProteomicsDBi48480 [O15156-1]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		O15156, 4 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...Antibodypediai		20407, 276 antibodies

The DNASU plasmid repository

More...DNASUi		51043

Genome annotation databases

EnsembliENST00000292176; ENSP00000292176; ENSG00000160685 [O15156-1]
ENST00000368426; ENSP00000357411; ENSG00000160685 [O15156-1]
ENST00000417934; ENSP00000406286; ENSG00000160685 [O15156-2]
ENST00000535420; ENSP00000438647; ENSG00000160685 [O15156-1]
GeneIDi51043
KEGGihsa:51043
UCSCiuc001fgk.5, human [O15156-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		51043
DisGeNETi51043

GeneCards: human genes, protein and diseases

More...GeneCardsi		ZBTB7B
HGNCiHGNC:18668, ZBTB7B
HPAiENSG00000160685, Tissue enhanced (intestine)
MIMi607646, gene
neXtProtiNX_O15156
OpenTargetsiENSG00000160685
PharmGKBiPA38630
VEuPathDBiHostDB:ENSG00000160685.13

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1721, Eukaryota
GeneTreeiENSGT00940000160219
HOGENOMiCLU_025627_0_0_1
InParanoidiO15156
OMAiPNGDDSP
OrthoDBi1318335at2759
PhylomeDBiO15156
TreeFamiTF331824

Enzyme and pathway databases

PathwayCommonsiO15156

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		51043, 41 hits in 1023 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ZBTB7B, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ZBTB7B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		51043
PharosiO15156, Tbio

Protein Ontology

More...PROi		PR:O15156
RNActiO15156, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000160685, Expressed in esophagus mucosa and 201 other tissues
GenevisibleiO15156, HS

Family and domain databases

InterProiView protein in InterPro
IPR000210, BTB/POZ_dom
IPR011333, SKP1/BTB/POZ_sf
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PfamiView protein in Pfam
PF00651, BTB, 1 hit
PF00096, zf-C2H2, 2 hits
SMARTiView protein in SMART
SM00225, BTB, 1 hit
SM00355, ZnF_C2H2, 4 hits
SUPFAMiSSF54695, SSF54695, 1 hit
SSF57667, SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS50097, BTB, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 3 hits
PS50157, ZINC_FINGER_C2H2_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZBT7B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15156
Secondary accession number(s): B4E3K5
, D3DV83, J3KQQ3, Q68DR2, Q96EP2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: August 16, 2004
Last modified: April 7, 2021
This is version 183 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again