Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger and BTB domain-containing protein 7B

Gene

ZBTB7B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. Exerts distinct biological functions in the mammary epithelial cells and T cells in a tissue-specific manner. Necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. Development of immature T-cell precursors (thymocytes) to either the CD4 helper or CD8 killer T-cell lineages correlates precisely with their T-cell receptor specificity for major histocompatibility complex class II or class I molecules, respectively. Cross-antagonism between ZBTB7B and CBF complexes are determinative to CD4 versus CD8 cell fate decision. Suppresses RUNX3 expression and imposes CD4+ lineage fate by inducing the SOCS suppressors of cytokine signaling. induces, as a transcriptional activator, SOCS genes expression which represses RUNX3 expression and promotes the CD4+ lineage fate. During CD4 lineage commitment, associates with multiple sites at the CD8 locus, acting as a negative regulator of the CD8 promoter and enhancers by epigenetic silencing through the recruitment of class II histone deacetylases, such as HDAC4 and HDAC5, to these loci. Regulates the development of IL17-producing CD1d-restricted naural killer (NK) T cells. Also functions as an important metabolic regulator in the lactating mammary glands. Critical feed-forward regulator of insulin signaling in mammary gland lactation, directly regulates expression of insulin receptor substrate-1 (IRS-1) and insulin-induced Akt-mTOR-SREBP signaling (By similarity). Transcriptional repressor of the collagen COL1A1 and COL1A2 genes. May also function as a repressor of fibronectin and possibly other extracellular matrix genes (PubMed:9370309). Potent driver of brown fat development, thermogenesis and cold-induced beige fat formation. Recruits the brown fat lncRNA 1 (Blnc1):HNRNPU ribonucleoprotein complex to activate thermogenic gene expression in brown and beige adipocytes (By similarity).By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri346 – 368C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri374 – 396C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri402 – 424C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri430 – 454C2H2-type 4; atypicalPROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, DNA-binding, Repressor
Biological processDifferentiation, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger and BTB domain-containing protein 7BCurated
Alternative name(s):
Krueppel-related zinc finger protein cKrox
Short name:
hcKrox
T-helper-inducing POZ/Krueppel-like factor
Zinc finger and BTB domain-containing protein 15
Zinc finger protein 67 homolog
Short name:
Zfp-67
Zinc finger protein 857B
Zinc finger protein Th-POK
Gene namesi
Name:ZBTB7BImported
Synonyms:ZBTB15, ZFP67, ZNF857B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000160685.13
HGNCiHGNC:18668 ZBTB7B
MIMi607646 gene
neXtProtiNX_O15156

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000160685
PharmGKBiPA38630

Polymorphism and mutation databases

BioMutaiZBTB7B

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000477191 – 539Zinc finger and BTB domain-containing protein 7BAdd BLAST539

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei150PhosphoserineCombined sources1
Modified residuei206N6-acetyllysine; by EP300; alternateBy similarity1
Cross-linki206Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei212N6-acetyllysine; by EP300; alternateBy similarity1
Cross-linki212Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei335N6-acetyllysine; by EP300; alternateBy similarity1
Cross-linki335Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei369PhosphothreonineCombined sources1

Post-translational modificationi

Acetylated directly and specifically by EP300 (PubMed:20810990). EP300-mediated acetylation of Lys-206, Lys-212 and Lys-335 stabilizes the protein by antagonizing ubiquitin conjugation (By similarity).By similarity1 Publication
Ubiquitinated, leading to proteasomal degradation (PubMed:20810990). Competes with acetylation on Lys-206, Lys-212 and Lys-335 (By similarity).By similarity1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiO15156
MaxQBiO15156
PaxDbiO15156
PeptideAtlasiO15156
PRIDEiO15156
ProteomicsDBi48480

PTM databases

iPTMnetiO15156
PhosphoSitePlusiO15156

Expressioni

Gene expression databases

BgeeiENSG00000160685
CleanExiHS_ZBTB7B
GenevisibleiO15156 HS

Organism-specific databases

HPAiHPA006811
HPA025820

Interactioni

Subunit structurei

Homodimerizes. Interacts with NCL, NEDD4 and YBX1. Interacts with HNRNPU (via RNA-binding RGG-box region); the interaction facilitates the recruitment of long non-coding RNA Blnc1 by ZBTB7B. Interacts with HDAC4 and HDAC5; the interaction allows the recruitment of HDAC4 and HDAC5 on CD8 loci for deacetylation and possible inhibition of CD8 genes expression.By similarity

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119242, 44 interactors
IntActiO15156, 31 interactors
MINTiO15156
STRINGi9606.ENSP00000292176

Structurei

3D structure databases

ProteinModelPortaliO15156
SMRiO15156
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini34 – 115BTBPROSITE-ProRule annotationAdd BLAST82

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni344 – 400Required for interaction with and acetylation by EP300By similarityAdd BLAST57

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi181 – 196Pro-richAdd BLAST16

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri346 – 368C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri374 – 396C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri402 – 424C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri430 – 454C2H2-type 4; atypicalPROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00920000148950
HOGENOMiHOG000082521
HOVERGENiHBG059461
InParanoidiO15156
KOiK10494
OMAiFPEHSNE
OrthoDBiEOG091G08VI
PhylomeDBiO15156
TreeFamiTF331824

Family and domain databases

InterProiView protein in InterPro
IPR000210 BTB/POZ_dom
IPR011333 SKP1/BTB/POZ_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00651 BTB, 1 hit
SMARTiView protein in SMART
SM00225 BTB, 1 hit
SM00355 ZnF_C2H2, 4 hits
SUPFAMiSSF54695 SSF54695, 1 hit
SSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS50097 BTB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 4 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15156-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSPEDDLIG IPFPDHSSEL LSCLNEQRQL GHLCDLTIRT QGLEYRTHRA
60 70 80 90 100
VLAACSHYFK KLFTEGGGGA VMGAGGSGTA TGGAGAGVCE LDFVGPEALG
110 120 130 140 150
ALLEFAYTAT LTTSSANMPA VLQAARLLEI PCVIAACMEI LQGSGLEAPS
160 170 180 190 200
PDEDDCERAR QYLEAFATAT ASGVPNGEDS PPQVPLPPPP PPPPRPVARR
210 220 230 240 250
SRKPRKAFLQ TKGARANHLV PEVPTVPAHP LTYEEEEVAG RVGSSGGSGP
260 270 280 290 300
GDSYSPPTGT ASPPEGPQSY EPYEGEEEEE ELVYPPAYGL AQGGGPPLSP
310 320 330 340 350
EELGSDEDAI DPDLMAYLSS LHQDNLAPGL DSQDKLVRKR RSQMPQECPV
360 370 380 390 400
CHKIIHGAGK LPRHMRTHTG EKPFACEVCG VRFTRNDKLK IHMRKHTGER
410 420 430 440 450
PYSCPHCPAR FLHSYDLKNH MHLHTGDRPY ECHLCHKAFA KEDHLQRHLK
460 470 480 490 500
GQNCLEVRTR RRRKDDAPPH YPPPSTAAAS PAGLDLSNGH LDTFRLSLAR
510 520 530
FWEQSAPTGP PVSTPGPPDD DEEEGAPTTP QAEGAMESS
Length:539
Mass (Da):58,027
Last modified:August 16, 2004 - v2
Checksum:i86B3616504B05B7E
GO
Isoform 2 (identifier: O15156-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLQPGPHPPSPQAAAPGEAWPGPSQAPWQSLEEKM

Note: No experimental confirmation available.
Show »
Length:573
Mass (Da):61,584
Checksum:iF85D79769C9BE294
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti90E → K in BAG65517 (PubMed:14702039).Curated1
Sequence conflicti235E → G in BAG65517 (PubMed:14702039).Curated1
Sequence conflicti437K → R in AAC51847 (PubMed:9370309).Curated1
Sequence conflicti480S → F in AAC51847 (PubMed:9370309).Curated1
Sequence conflicti509 – 510GP → WA in AAC51847 (PubMed:9370309).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0447211M → MLQPGPHPPSPQAAAPGEAW PGPSQAPWQSLEEKM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007833 mRNA Translation: AAC51847.1
AK304762 mRNA Translation: BAG65517.1
CR749303 mRNA Translation: CAH18158.1
AL451085 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53149.1
CH471121 Genomic DNA Translation: EAW53150.1
CH471121 Genomic DNA Translation: EAW53151.1
BC012070 mRNA Translation: AAH12070.1
CCDSiCCDS1081.1 [O15156-1]
CCDS58030.1 [O15156-2]
RefSeqiNP_001239335.1, NM_001252406.2 [O15156-2]
NP_001243384.1, NM_001256455.1 [O15156-1]
XP_006711412.2, XM_006711349.2 [O15156-1]
XP_006711416.1, XM_006711353.1 [O15156-1]
XP_006711417.1, XM_006711354.1 [O15156-1]
XP_006711419.1, XM_006711356.3 [O15156-1]
XP_006711420.1, XM_006711357.1 [O15156-1]
XP_006711421.1, XM_006711358.1 [O15156-1]
XP_006711422.1, XM_006711359.2 [O15156-1]
XP_011507900.1, XM_011509598.2 [O15156-2]
XP_011507901.1, XM_011509599.2 [O15156-1]
UniGeneiHs.729279
Hs.744441

Genome annotation databases

EnsembliENST00000292176; ENSP00000292176; ENSG00000160685 [O15156-1]
ENST00000368426; ENSP00000357411; ENSG00000160685 [O15156-1]
ENST00000417934; ENSP00000406286; ENSG00000160685 [O15156-2]
ENST00000535420; ENSP00000438647; ENSG00000160685 [O15156-1]
GeneIDi51043
KEGGihsa:51043
UCSCiuc001fgk.5 human [O15156-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiZBT7B_HUMAN
AccessioniPrimary (citable) accession number: O15156
Secondary accession number(s): B4E3K5
, D3DV83, J3KQQ3, Q68DR2, Q96EP2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: August 16, 2004
Last modified: July 18, 2018
This is version 161 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health