BET1

Functionⁱ

Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane (By similarity).By similarity

GO - Biological processⁱ

COPII vesicle coating Source: Reactome
ER to Golgi vesicle-mediated transport Source: Reactome
protein transport Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	ER-Golgi transport, Protein transport, Transport

Biological process

ER-Golgi transport, Protein transport, Transport

Enzyme and pathway databases

Reactomeⁱ	R-HSA-204005 COPII-mediated vesicle transport R-HSA-6807878 COPI-mediated anterograde transport

Reactomeⁱ

R-HSA-204005 COPII-mediated vesicle transport
R-HSA-6807878 COPI-mediated anterograde transport

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: BET1 homolog Short name: hBET1 Alternative name(s): Golgi vesicular membrane-trafficking protein p18
Gene namesⁱ	Name:BET1
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 7

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000105829.11
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:14562 BET1
MIMⁱ	605456 gene
neXtProtⁱ	NX_O15155

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 94	CytoplasmicSequence analysisAdd BLAST	94
Transmembraneⁱ	95 – 115	Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST	21
Topological domainⁱ	116 – 118	VesicularSequence analysis	3

Keywords - Cellular componentⁱ

Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	10282
Open Targets More...OpenTargetsⁱ	ENSG00000105829
PharmGKBⁱ	PA25338

Polymorphism and mutation databases

BioMutaⁱ	BET1

BioMutaⁱ

BET1

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000206884	1 – 118	BET1 homologAdd BLAST		118

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	50	PhosphoserineCombined sources		1

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

EPDⁱ	O15155
PaxDbⁱ	O15155
PeptideAtlas More...PeptideAtlasⁱ	O15155
PRIDEⁱ	O15155
ProteomicsDBⁱ	48479
TopDownProteomicsⁱ	O15155-1 [O15155-1]

PTM databases

iPTMnetⁱ	O15155
PhosphoSitePlusⁱ	O15155
SwissPalmⁱ	O15155

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000105829 Expressed in 219 organ(s), highest expression level in testis
CleanExⁱ	HS_BET1
ExpressionAtlasⁱ	O15155 baseline and differential
Genevisibleⁱ	O15155 HS

Interactionⁱ

Subunit structureⁱ

Interacts with STX17.By similarity

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
GOSR2	O14653	4	EBI-749204,EBI-4401517
MAGEA6	P43360	3	EBI-749204,EBI-1045155
STX4	Q12846	5	EBI-749204,EBI-744942
USHBP1	Q8N6Y0	2	EBI-749204,EBI-739895

Protein-protein interaction databases

BioGridⁱ	115571, 28 interactors
IntActⁱ	O15155, 303 interactors
Molecular INTeraction database More...MINTⁱ	O15155
STRINGⁱ	9606.ENSP00000222547

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	O15155
SMRⁱ	O15155
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

O15155

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	26 – 88	t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST		63

Sequence similaritiesⁱ

Belongs to the BET1 family.Curated

Keywords - Domainⁱ

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG3385 Eukaryota ENOG4111W10 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00570000079186
HOGENOMⁱ	HOG000290697
HOVERGENⁱ	HBG029661
InParanoidⁱ	O15155
KEGG Orthology (KO) More...KOⁱ	K08504
PhylomeDBⁱ	O15155
TreeFamⁱ	TF323307

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd15853 SNARE_Bet1, 1 hit
InterProⁱ	View protein in InterPro IPR039897 BET1 IPR039899 BET1_SNARE IPR000727 T_SNARE_dom
PANTHERⁱ	PTHR12791 PTHR12791, 1 hit
SMARTⁱ	View protein in SMART SM00397 t_SNARE, 1 hit
PROSITEⁱ	View protein in PROSITE PS50192 T_SNARE, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: O15155-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRAGLGEGV PPGNYGNYGY ANSGYSACEE ENERLTESLR SKVTAIKSLS 
        60         70         80         90        100
IEIGHEVKTQ NKLLAEMDSQ FDSTTGFLGK TMGKLKILSR GSQTKLLCYM 
       110 
MLFSLFVFFI IYWIIKLR

Length:118

Mass (Da):13,289

Last modified:January 1, 1998 - v1

Checksum:ⁱB83B76ACBB3DA57E

GO

Isoform 2 (identifier: O15155-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
80-118: KTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR → LCPM

« Hide

        10         20         30         40         50
MRRAGLGEGV PPGNYGNYGY ANSGYSACEE ENERLTESLR SKVTAIKSLS 
        60         70         80 
IEIGHEVKTQ NKLLAEMDSQ FDSTTGFLGL CPM

Note: No experimental confirmation available.

Show »

Length:83

Mass (Da):9,020

Checksum:ⁱ71D35D46B020CD54

GO

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

H7C1N3	H7C1N3_HUMAN	BET1 homolog BET1 homolog	BET1	133	Annotation score:
Q68DU7	Q68DU7_HUMAN	BET1 homolog BET1 homolog	BET1 DKFZp781C0425	127	Annotation score:
C9JTT8	C9JTT8_HUMAN	BET1 homolog BET1 homolog	BET1	98	Annotation score:

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_056216	80 – 118	KTMGK…IIKLR → LCPM in isoform 2. 1 PublicationAdd BLAST		39

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF007551 mRNA Translation: AAB62941.1 AC006378 Genomic DNA Translation: AAD47132.1 CH471091 Genomic DNA Translation: EAW76802.1 BC000899 mRNA Translation: AAH00899.1 BC012595 mRNA Translation: AAH12595.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS5635.1 [O15155-1] CCDS83203.1 [O15155-2]
NCBI Reference Sequences More...RefSeqⁱ	NP_001304668.1, NM_001317739.1 [O15155-2] NP_005859.1, NM_005868.5 [O15155-1]
UniGeneⁱ	Hs.489132

Genome annotation databases

Ensemblⁱ	ENST00000222547; ENSP00000222547; ENSG00000105829 [O15155-1] ENST00000433727; ENSP00000391228; ENSG00000105829 [O15155-2]
GeneIDⁱ	10282
KEGGⁱ	hsa:10282
UCSC genome browser More...UCSCⁱ	uc064fkr.1 human [O15155-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O15155	BET1 homolog (S. cerevisiae)		HUMAN		118	UniRef100_O15155
BET1 isoform 4		PANTR		118
BET1 isoform 1		PONAB		118
Uncharacterized protein		PANPA		118
Bet1 golgi vesicular membrane trafficking protein		GORGO		118
O15155-2	Uncharacterized protein		NOMLE		90	UniRef100_A0A2I3GVJ8
BET1 isoform 5		PANTR		83
BET1 isoform 3		PONAB		83
Uncharacterized protein		PANPA		83

Protein	Similar proteins		Species	Score	Length	Source
O15155	BET1 homolog (S. cerevisiae)		HUMAN		118	UniRef90_O15155
BET1 isoform 4		PANTR		118
BET1 isoform 1		PONAB		118
Uncharacterized protein		PANPA		118
Bet1 golgi vesicular membrane trafficking protein		GORGO		118
+57
O15155-2	Uncharacterized protein		NOMLE		90	UniRef90_A0A2I3GVJ8
BET1 isoform 5		PANTR		83
BET1 isoform 3		PONAB		83
Uncharacterized protein		PANPA		83
Uncharacterized protein		PAPAN		83

Protein	Similar proteins		Species	Score	Length	Source
O15155	BET1 homolog (S. cerevisiae)		HUMAN		118	UniRef50_O15155
BET1 isoform 4		PANTR		118
BET1 isoform 1		PONAB		118
Uncharacterized protein		PANPA		118
Bet1 golgi vesicular membrane trafficking protein		GORGO		118
+59
O15155-2	Uncharacterized protein		NOMLE		90	UniRef50_A0A2I3GVJ8
BET1 isoform 5		PANTR		83
BET1 isoform 3		PONAB		83
Uncharacterized protein		PANPA		83
Uncharacterized protein		PAPAN		83
+5

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF007551 mRNA Translation: AAB62941.1 AC006378 Genomic DNA Translation: AAD47132.1 CH471091 Genomic DNA Translation: EAW76802.1 BC000899 mRNA Translation: AAH00899.1 BC012595 mRNA Translation: AAH12595.1
CCDSⁱ	CCDS5635.1 [O15155-1] CCDS83203.1 [O15155-2]
RefSeqⁱ	NP_001304668.1, NM_001317739.1 [O15155-2] NP_005859.1, NM_005868.5 [O15155-1]
UniGeneⁱ	Hs.489132

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	3EGX	X-ray	3.30	D	24-32	[»]
ProteinModelPortalⁱ	O15155
SMRⁱ	O15155
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	115571, 28 interactors
IntActⁱ	O15155, 303 interactors
MINTⁱ	O15155
STRINGⁱ	9606.ENSP00000222547

PTM databases

iPTMnetⁱ	O15155
PhosphoSitePlusⁱ	O15155
SwissPalmⁱ	O15155

Polymorphism and mutation databases

BioMutaⁱ	BET1

BioMutaⁱ

BET1

Proteomic databases

EPDⁱ	O15155
PaxDbⁱ	O15155
PeptideAtlasⁱ	O15155
PRIDEⁱ	O15155
ProteomicsDBⁱ	48479
TopDownProteomicsⁱ	O15155-1 [O15155-1]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	10282
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000222547; ENSP00000222547; ENSG00000105829 [O15155-1] ENST00000433727; ENSP00000391228; ENSG00000105829 [O15155-2]
GeneIDⁱ	10282
KEGGⁱ	hsa:10282
UCSCⁱ	uc064fkr.1 human [O15155-1]

Organism-specific databases

CTDⁱ	10282
DisGeNETⁱ	10282
EuPathDBⁱ	HostDB:ENSG00000105829.11
GeneCardsⁱ	BET1
HGNCⁱ	HGNC:14562 BET1
MIMⁱ	605456 gene
neXtProtⁱ	NX_O15155
OpenTargetsⁱ	ENSG00000105829
PharmGKBⁱ	PA25338
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG3385 Eukaryota ENOG4111W10 LUCA
GeneTreeⁱ	ENSGT00570000079186
HOGENOMⁱ	HOG000290697
HOVERGENⁱ	HBG029661
InParanoidⁱ	O15155
KOⁱ	K08504
PhylomeDBⁱ	O15155
TreeFamⁱ	TF323307

Enzyme and pathway databases

Reactomeⁱ	R-HSA-204005 COPII-mediated vesicle transport R-HSA-6807878 COPI-mediated anterograde transport

Reactomeⁱ

R-HSA-204005 COPII-mediated vesicle transport
R-HSA-6807878 COPI-mediated anterograde transport

Miscellaneous databases

EvolutionaryTraceⁱ	O15155
GeneWikiⁱ	BET1
GenomeRNAiⁱ	10282
Protein Ontology More...PROⁱ	PR:O15155
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000105829 Expressed in 219 organ(s), highest expression level in testis
CleanExⁱ	HS_BET1
ExpressionAtlasⁱ	O15155 baseline and differential
Genevisibleⁱ	O15155 HS

Family and domain databases

CDDⁱ	cd15853 SNARE_Bet1, 1 hit
InterProⁱ	View protein in InterPro IPR039897 BET1 IPR039899 BET1_SNARE IPR000727 T_SNARE_dom
PANTHERⁱ	PTHR12791 PTHR12791, 1 hit
SMARTⁱ	View protein in SMART SM00397 t_SNARE, 1 hit
PROSITEⁱ	View protein in PROSITE PS50192 T_SNARE, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	BET1_HUMAN
Accessionⁱ	O15155Primary (citable) accession number: O15155 Secondary accession number(s): Q96EA0
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	January 17, 2003
	Last sequence update:	January 1, 1998
	Last modified:	November 7, 2018
	This is version 147 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 7
Human chromosome 7: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O15155 (BET1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

BET1 homolog

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Golgi apparatus

Endoplasmic reticulum

Endoplasmic reticulum

Golgi apparatus

Other locations

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ