Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BET1 homolog

Gene

BET1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane (By similarity).By similarity

GO - Biological processi

Keywordsi

Biological processER-Golgi transport, Protein transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-204005 COPII-mediated vesicle transport
R-HSA-6807878 COPI-mediated anterograde transport

Names & Taxonomyi

Protein namesi
Recommended name:
BET1 homolog
Short name:
hBET1
Alternative name(s):
Golgi vesicular membrane-trafficking protein p18
Gene namesi
Name:BET1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000105829.11
HGNCiHGNC:14562 BET1
MIMi605456 gene
neXtProtiNX_O15155

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 94CytoplasmicSequence analysisAdd BLAST94
Transmembranei95 – 115Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini116 – 118VesicularSequence analysis3

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi10282
OpenTargetsiENSG00000105829
PharmGKBiPA25338

Polymorphism and mutation databases

BioMutaiBET1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002068841 – 118BET1 homologAdd BLAST118

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei50PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO15155
PaxDbiO15155
PeptideAtlasiO15155
PRIDEiO15155
ProteomicsDBi48479
TopDownProteomicsiO15155-1 [O15155-1]

PTM databases

iPTMnetiO15155
PhosphoSitePlusiO15155
SwissPalmiO15155

Expressioni

Gene expression databases

BgeeiENSG00000105829 Expressed in 219 organ(s), highest expression level in testis
CleanExiHS_BET1
ExpressionAtlasiO15155 baseline and differential
GenevisibleiO15155 HS

Interactioni

Subunit structurei

Interacts with STX17.By similarity

Binary interactionsi

Protein-protein interaction databases

BioGridi115571, 28 interactors
IntActiO15155, 303 interactors
MINTiO15155
STRINGi9606.ENSP00000222547

Structurei

3D structure databases

ProteinModelPortaliO15155
SMRiO15155
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15155

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini26 – 88t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST63

Sequence similaritiesi

Belongs to the BET1 family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3385 Eukaryota
ENOG4111W10 LUCA
GeneTreeiENSGT00570000079186
HOGENOMiHOG000290697
HOVERGENiHBG029661
InParanoidiO15155
KOiK08504
PhylomeDBiO15155
TreeFamiTF323307

Family and domain databases

CDDicd15853 SNARE_Bet1, 1 hit
InterProiView protein in InterPro
IPR039897 BET1
IPR039899 BET1_SNARE
IPR000727 T_SNARE_dom
PANTHERiPTHR12791 PTHR12791, 1 hit
SMARTiView protein in SMART
SM00397 t_SNARE, 1 hit
PROSITEiView protein in PROSITE
PS50192 T_SNARE, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15155-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRRAGLGEGV PPGNYGNYGY ANSGYSACEE ENERLTESLR SKVTAIKSLS
60 70 80 90 100
IEIGHEVKTQ NKLLAEMDSQ FDSTTGFLGK TMGKLKILSR GSQTKLLCYM
110
MLFSLFVFFI IYWIIKLR
Length:118
Mass (Da):13,289
Last modified:January 1, 1998 - v1
Checksum:iB83B76ACBB3DA57E
GO
Isoform 2 (identifier: O15155-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-118: KTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR → LCPM

Note: No experimental confirmation available.
Show »
Length:83
Mass (Da):9,020
Checksum:i71D35D46B020CD54
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C1N3H7C1N3_HUMAN
BET1 homolog
BET1
133Annotation score:
Q68DU7Q68DU7_HUMAN
BET1 homolog
BET1 DKFZp781C0425
127Annotation score:
C9JTT8C9JTT8_HUMAN
BET1 homolog
BET1
98Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05621680 – 118KTMGK…IIKLR → LCPM in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007551 mRNA Translation: AAB62941.1
AC006378 Genomic DNA Translation: AAD47132.1
CH471091 Genomic DNA Translation: EAW76802.1
BC000899 mRNA Translation: AAH00899.1
BC012595 mRNA Translation: AAH12595.1
CCDSiCCDS5635.1 [O15155-1]
CCDS83203.1 [O15155-2]
RefSeqiNP_001304668.1, NM_001317739.1 [O15155-2]
NP_005859.1, NM_005868.5 [O15155-1]
UniGeneiHs.489132

Genome annotation databases

EnsembliENST00000222547; ENSP00000222547; ENSG00000105829 [O15155-1]
ENST00000433727; ENSP00000391228; ENSG00000105829 [O15155-2]
GeneIDi10282
KEGGihsa:10282
UCSCiuc064fkr.1 human [O15155-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007551 mRNA Translation: AAB62941.1
AC006378 Genomic DNA Translation: AAD47132.1
CH471091 Genomic DNA Translation: EAW76802.1
BC000899 mRNA Translation: AAH00899.1
BC012595 mRNA Translation: AAH12595.1
CCDSiCCDS5635.1 [O15155-1]
CCDS83203.1 [O15155-2]
RefSeqiNP_001304668.1, NM_001317739.1 [O15155-2]
NP_005859.1, NM_005868.5 [O15155-1]
UniGeneiHs.489132

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3EGXX-ray3.30D24-32[»]
ProteinModelPortaliO15155
SMRiO15155
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115571, 28 interactors
IntActiO15155, 303 interactors
MINTiO15155
STRINGi9606.ENSP00000222547

PTM databases

iPTMnetiO15155
PhosphoSitePlusiO15155
SwissPalmiO15155

Polymorphism and mutation databases

BioMutaiBET1

Proteomic databases

EPDiO15155
PaxDbiO15155
PeptideAtlasiO15155
PRIDEiO15155
ProteomicsDBi48479
TopDownProteomicsiO15155-1 [O15155-1]

Protocols and materials databases

DNASUi10282
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000222547; ENSP00000222547; ENSG00000105829 [O15155-1]
ENST00000433727; ENSP00000391228; ENSG00000105829 [O15155-2]
GeneIDi10282
KEGGihsa:10282
UCSCiuc064fkr.1 human [O15155-1]

Organism-specific databases

CTDi10282
DisGeNETi10282
EuPathDBiHostDB:ENSG00000105829.11
GeneCardsiBET1
HGNCiHGNC:14562 BET1
MIMi605456 gene
neXtProtiNX_O15155
OpenTargetsiENSG00000105829
PharmGKBiPA25338
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3385 Eukaryota
ENOG4111W10 LUCA
GeneTreeiENSGT00570000079186
HOGENOMiHOG000290697
HOVERGENiHBG029661
InParanoidiO15155
KOiK08504
PhylomeDBiO15155
TreeFamiTF323307

Enzyme and pathway databases

ReactomeiR-HSA-204005 COPII-mediated vesicle transport
R-HSA-6807878 COPI-mediated anterograde transport

Miscellaneous databases

EvolutionaryTraceiO15155
GeneWikiiBET1
GenomeRNAii10282
PROiPR:O15155
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000105829 Expressed in 219 organ(s), highest expression level in testis
CleanExiHS_BET1
ExpressionAtlasiO15155 baseline and differential
GenevisibleiO15155 HS

Family and domain databases

CDDicd15853 SNARE_Bet1, 1 hit
InterProiView protein in InterPro
IPR039897 BET1
IPR039899 BET1_SNARE
IPR000727 T_SNARE_dom
PANTHERiPTHR12791 PTHR12791, 1 hit
SMARTiView protein in SMART
SM00397 t_SNARE, 1 hit
PROSITEiView protein in PROSITE
PS50192 T_SNARE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiBET1_HUMAN
AccessioniPrimary (citable) accession number: O15155
Secondary accession number(s): Q96EA0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 1, 1998
Last modified: November 7, 2018
This is version 147 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again