Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O15155 (BET1_HUMAN)

Entry version 158 (17 Jun 2020)
Sequence version 1 (01 Jan 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

BET1 homolog

Gene

BET1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processER-Golgi transport, Protein transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-204005 COPII-mediated vesicle transport
R-HSA-6807878 COPI-mediated anterograde transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
BET1 homolog
Short name:
hBET1
Alternative name(s):
Golgi vesicular membrane-trafficking protein p18
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BET1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000105829.11

Human Gene Nomenclature Database

More...HGNCi		HGNC:14562 BET1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605456 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O15155

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 94CytoplasmicSequence analysisAdd BLAST94
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei95 – 115Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini116 – 118VesicularSequence analysis3

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		10282

Open Targets

More...OpenTargetsi		ENSG00000105829

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA25338

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O15155 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		BET1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002068841 – 118BET1 homologAdd BLAST118

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei50PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O15155

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O15155

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O15155

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O15155

PeptideAtlas

More...PeptideAtlasi		O15155

PRoteomics IDEntifications database

More...PRIDEi		O15155

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		48479 [O15155-1]
76387

Consortium for Top Down Proteomics

More...TopDownProteomicsi		O15155-1 [O15155-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O15155

MetOSite database of methionine sulfoxide sites

More...MetOSitei		O15155

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O15155

SwissPalm database of S-palmitoylation events

More...SwissPalmi		O15155

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000105829 Expressed in testis and 218 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O15155 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O15155 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000105829 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with STX17.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details
O15155
With#Exp.IntAct
ADORA2A [P29274]3EBI-749204,EBI-2902702
ANKS6 [Q68DC2]3EBI-749204,EBI-7054139
AQP6 [Q13520]3EBI-749204,EBI-13059134
ASGR2 - isoform 3 [P07307-3]3EBI-749204,EBI-12808270
ASZ1 [Q8WWH4]3EBI-749204,EBI-12239061
CCDC155 [Q8N6L0]3EBI-749204,EBI-749265
CD74 - isoform 2 [P04233-2]3EBI-749204,EBI-12222807
CD79A [P11912]3EBI-749204,EBI-7797864
CGRRF1 [Q99675]3EBI-749204,EBI-2130213
CISD2 [Q8N5K1]3EBI-749204,EBI-1045797
CLDN7 [O95471]3EBI-749204,EBI-740744
CLEC10A [Q8IUN9]3EBI-749204,EBI-2873246
CRB3 - isoform 2 [Q9BUF7-2]3EBI-749204,EBI-17233035
CREB3L1 [Q96BA8]3EBI-749204,EBI-6942903
CYB561 [P49447]3EBI-749204,EBI-8646596
CYBC1 [Q9BQA9]3EBI-749204,EBI-2680384
ELOVL4 [Q9GZR5]3EBI-749204,EBI-18535450
ERGIC3 [Q9Y282]3EBI-749204,EBI-781551
FAM174A [Q8TBP5]3EBI-749204,EBI-18636064
FAM209A [Q5JX71]3EBI-749204,EBI-18304435
FAM210B [Q96KR6]3EBI-749204,EBI-18938272
GOSR2 [O14653]5EBI-749204,EBI-4401517
GPR152 [Q8TDT2]3EBI-749204,EBI-13345167
GPX8 [Q8TED1]3EBI-749204,EBI-11721746
JAGN1 [Q8N5M9]3EBI-749204,EBI-10266796
KCNJ6 [P48051]3EBI-749204,EBI-12017638
LYPD5 [Q6UWN5]3EBI-749204,EBI-17200970
MAGEA6 [P43360]3EBI-749204,EBI-1045155
MFF - isoform 5 [Q9GZY8-5]3EBI-749204,EBI-11956541
MGST3 [O14880]3EBI-749204,EBI-724754
NAPB [Q9H115]3EBI-749204,EBI-3921185
PTGES [O14684]3EBI-749204,EBI-11161398
REEP4 [Q9H6H4]3EBI-749204,EBI-7545592
RETREG3 [Q86VR2]3EBI-749204,EBI-10192441
SLC26A6 - isoform 3 [Q9BXS9-3]3EBI-749204,EBI-12814225
SLC7A14 [Q8TBB6]3EBI-749204,EBI-5235586
SSMEM1 [Q8WWF3]3EBI-749204,EBI-17280858
STX1A [Q16623]3EBI-749204,EBI-712466
STX1B [P61266]3EBI-749204,EBI-9071709
STX2 - isoform 1 [P32856-2]3EBI-749204,EBI-11956649
STX4 [Q12846]6EBI-749204,EBI-744942
TMCO5A [Q8N6Q1]3EBI-749204,EBI-12821895
TMEM237 - isoform 2 [Q96Q45-2]3EBI-749204,EBI-10982110
TMEM35A [Q53FP2]3EBI-749204,EBI-11722971
TMEM52B [Q4KMG9]3EBI-749204,EBI-18178701
TMEM80 [Q96HE8]3EBI-749204,EBI-11742770
TMX2 [Q9Y320]3EBI-749204,EBI-6447886
USHBP1 [Q8N6Y0]2EBI-749204,EBI-739895

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		115571, 281 interactors

Protein interaction database and analysis system

More...IntActi		O15155, 317 interactors

Molecular INTeraction database

More...MINTi		O15155

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000222547

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O15155 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O15155

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O15155

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini26 – 88t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST63

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the BET1 family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3385 Eukaryota
ENOG4111W10 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162637

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_086133_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O15155

KEGG Orthology (KO)

More...KOi		K08504

Database for complete collections of gene phylogenies

More...PhylomeDBi		O15155

TreeFam database of animal gene trees

More...TreeFami		TF323307

Family and domain databases

Conserved Domains Database

More...CDDi		cd15853 SNARE_Bet1, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR039897 BET1
IPR039899 BET1_SNARE
IPR000727 T_SNARE_dom

The PANTHER Classification System

More...PANTHERi		PTHR12791 PTHR12791, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00397 t_SNARE, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50192 T_SNARE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15155-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRRAGLGEGV PPGNYGNYGY ANSGYSACEE ENERLTESLR SKVTAIKSLS 
        60         70         80         90        100
IEIGHEVKTQ NKLLAEMDSQ FDSTTGFLGK TMGKLKILSR GSQTKLLCYM 
       110 
MLFSLFVFFI IYWIIKLR
Length:118
Mass (Da):13,289
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB83B76ACBB3DA57E
GO
Isoform 2 (identifier: O15155-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-118: KTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR → LCPM

Show »
Length:83
Mass (Da):9,020
Checksum:i71D35D46B020CD54
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C1N3H7C1N3_HUMAN
BET1 homolog
BET1
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q68DU7Q68DU7_HUMAN
BET1 homolog
BET1 DKFZp781C0425
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JTT8C9JTT8_HUMAN
BET1 homolog
BET1
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IU16A0A3B3IU16_HUMAN
BET1 homolog
BET1
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05621680 – 118KTMGK…IIKLR → LCPM in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF007551 mRNA Translation: AAB62941.1
AC006378 Genomic DNA Translation: AAD47132.1
CH471091 Genomic DNA Translation: EAW76802.1
BC000899 mRNA Translation: AAH00899.1
BC012595 mRNA Translation: AAH12595.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS5635.1 [O15155-1]
CCDS83203.1 [O15155-2]

NCBI Reference Sequences

More...RefSeqi		NP_001304668.1, NM_001317739.1 [O15155-2]
NP_005859.1, NM_005868.5 [O15155-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000222547; ENSP00000222547; ENSG00000105829 [O15155-1]
ENST00000433727; ENSP00000391228; ENSG00000105829 [O15155-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10282

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10282

UCSC genome browser

More...UCSCi		uc064fkr.1 human [O15155-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007551 mRNA Translation: AAB62941.1
AC006378 Genomic DNA Translation: AAD47132.1
CH471091 Genomic DNA Translation: EAW76802.1
BC000899 mRNA Translation: AAH00899.1
BC012595 mRNA Translation: AAH12595.1
CCDSiCCDS5635.1 [O15155-1]
CCDS83203.1 [O15155-2]
RefSeqiNP_001304668.1, NM_001317739.1 [O15155-2]
NP_005859.1, NM_005868.5 [O15155-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3EGXX-ray3.30D24-32[»]
SMRiO15155
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi115571, 281 interactors
IntActiO15155, 317 interactors
MINTiO15155
STRINGi9606.ENSP00000222547

PTM databases

iPTMnetiO15155
MetOSiteiO15155
PhosphoSitePlusiO15155
SwissPalmiO15155

Polymorphism and mutation databases

BioMutaiBET1

Proteomic databases

EPDiO15155
jPOSTiO15155
MassIVEiO15155
PaxDbiO15155
PeptideAtlasiO15155
PRIDEiO15155
ProteomicsDBi48479 [O15155-1]
76387
TopDownProteomicsiO15155-1 [O15155-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		64131 38 antibodies

The DNASU plasmid repository

More...DNASUi		10282

Genome annotation databases

EnsembliENST00000222547; ENSP00000222547; ENSG00000105829 [O15155-1]
ENST00000433727; ENSP00000391228; ENSG00000105829 [O15155-2]
GeneIDi10282
KEGGihsa:10282
UCSCiuc064fkr.1 human [O15155-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10282
DisGeNETi10282
EuPathDBiHostDB:ENSG00000105829.11

GeneCards: human genes, protein and diseases

More...GeneCardsi		BET1
HGNCiHGNC:14562 BET1
HPAiENSG00000105829 Low tissue specificity
MIMi605456 gene
neXtProtiNX_O15155
OpenTargetsiENSG00000105829
PharmGKBiPA25338

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3385 Eukaryota
ENOG4111W10 LUCA
GeneTreeiENSGT00940000162637
HOGENOMiCLU_086133_2_1_1
InParanoidiO15155
KOiK08504
PhylomeDBiO15155
TreeFamiTF323307

Enzyme and pathway databases

ReactomeiR-HSA-204005 COPII-mediated vesicle transport
R-HSA-6807878 COPI-mediated anterograde transport

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		10282 306 hits in 780 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		BET1 human
EvolutionaryTraceiO15155

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		BET1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10282
PharosiO15155 Tdark

Protein Ontology

More...PROi		PR:O15155
RNActiO15155 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000105829 Expressed in testis and 218 other tissues
ExpressionAtlasiO15155 baseline and differential
GenevisibleiO15155 HS

Family and domain databases

CDDicd15853 SNARE_Bet1, 1 hit
InterProiView protein in InterPro
IPR039897 BET1
IPR039899 BET1_SNARE
IPR000727 T_SNARE_dom
PANTHERiPTHR12791 PTHR12791, 1 hit
SMARTiView protein in SMART
SM00397 t_SNARE, 1 hit
PROSITEiView protein in PROSITE
PS50192 T_SNARE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBET1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15155
Secondary accession number(s): Q96EA0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 1, 1998
Last modified: June 17, 2020
This is version 158 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again