Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pro-FMRFamide-related neuropeptide FF

Gene

NPFF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Protein inferred from homologyi

Functioni

Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels.1 Publication

GO - Molecular functioni

  • G protein-coupled receptor binding Source: GO_Central
  • neuropeptide hormone activity Source: GO_Central
  • signaling receptor binding Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionNeuropeptide

Enzyme and pathway databases

ReactomeiR-HSA-389397 Orexin and neuropeptides FF and QRFP bind to their respective receptors
R-HSA-416476 G alpha (q) signalling events
SIGNORiO15130

Names & Taxonomyi

Protein namesi
Recommended name:
Pro-FMRFamide-related neuropeptide FF
Alternative name(s):
FMRFamide-related peptides
Cleaved into the following 3 chains:
Neuropeptide SF
Short name:
NPSF
Neuropeptide FF
Short name:
NPFF
Neuropeptide AF
Short name:
NPAF
Gene namesi
Name:NPFF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000139574.8
HGNCiHGNC:7901 NPFF
MIMi604643 gene
neXtProtiNX_O15130

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi8620
OpenTargetsiENSG00000139574
PharmGKBiPA31704

Polymorphism and mutation databases

BioMutaiNPFF

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Sequence analysisAdd BLAST20
PropeptideiPRO_000000989821 – 65Add BLAST45
PeptideiPRO_000000989966 – 76Neuropeptide SFAdd BLAST11
PeptideiPRO_000000990069 – 76Neuropeptide FF8
PropeptideiPRO_000000990179 – 92Add BLAST14
PeptideiPRO_000000990293 – 110Neuropeptide AFAdd BLAST18

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei76Phenylalanine amideBy similarity1
Modified residuei110Phenylalanine amideBy similarity1

Keywords - PTMi

Amidation, Cleavage on pair of basic residues

Proteomic databases

PaxDbiO15130
PRIDEiO15130
ProteomicsDBi48466

Expressioni

Gene expression databases

BgeeiENSG00000139574 Expressed in 56 organ(s), highest expression level in cerebellum
CleanExiHS_NPFF
GenevisibleiO15130 HS

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114175, 1 interactor
IntActiO15130, 2 interactors
STRINGi9606.ENSP00000267017

Structurei

3D structure databases

ProteinModelPortaliO15130
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410J2TH Eukaryota
ENOG410Z134 LUCA
GeneTreeiENSGT00390000015021
HOGENOMiHOG000113843
HOVERGENiHBG006519
InParanoidiO15130
KOiK05247
OMAiLIDQGCA
OrthoDBiEOG091G0YN1
PhylomeDBiO15130
TreeFamiTF330924

Family and domain databases

InterProiView protein in InterPro
IPR008065 NPFF
PANTHERiPTHR15044 PTHR15044, 1 hit
PfamiView protein in Pfam
PF15085 NPFF, 1 hit
PIRSFiPIRSF038092 FMRFamid-rel_pep_precur, 1 hit
PRINTSiPR01682 FMRFAMIDEPEP

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O15130-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSRQAAALL VLLLLIDGGC AEGPGGQQED QLSAEEDSEP LPPQDAQTSG
60 70 80 90 100
SLLHYLLQAM ERPGRSQAFL FQPQRFGRNT QGSWRNEWLS PRAGEGLNSQ
110
FWSLAAPQRF GKK
Length:113
Mass (Da):12,440
Last modified:January 1, 1998 - v1
Checksum:i1E9D4ED2A69238E3
GO
Isoform 2 (identifier: O15130-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSA → MVPQPPTTCPWKPVPSPCDLRVQGICPSSFPDTPLAQ

Note: No experimental confirmation available.
Show »
Length:116
Mass (Da):12,991
Checksum:i0E1EB094309C3105
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04918388W → R. Corresponds to variant dbSNP:rs35822762Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0564751 – 34MDSRQ…DQLSA → MVPQPPTTCPWKPVPSPCDL RVQGICPSSFPDTPLAQ in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF005271 mRNA Translation: AAB64288.1
AC023509 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW96721.1
BC104234 mRNA Translation: AAI04235.1
BC104235 mRNA Translation: AAI04236.1
CCDSiCCDS8862.1 [O15130-1]
RefSeqiNP_001307225.1, NM_001320296.1 [O15130-2]
NP_003708.1, NM_003717.3 [O15130-1]
UniGeneiHs.733076

Genome annotation databases

EnsembliENST00000267017; ENSP00000267017; ENSG00000139574 [O15130-1]
GeneIDi8620
KEGGihsa:8620
UCSCiuc001sdw.1 human [O15130-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF005271 mRNA Translation: AAB64288.1
AC023509 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW96721.1
BC104234 mRNA Translation: AAI04235.1
BC104235 mRNA Translation: AAI04236.1
CCDSiCCDS8862.1 [O15130-1]
RefSeqiNP_001307225.1, NM_001320296.1 [O15130-2]
NP_003708.1, NM_003717.3 [O15130-1]
UniGeneiHs.733076

3D structure databases

ProteinModelPortaliO15130
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114175, 1 interactor
IntActiO15130, 2 interactors
STRINGi9606.ENSP00000267017

Polymorphism and mutation databases

BioMutaiNPFF

Proteomic databases

PaxDbiO15130
PRIDEiO15130
ProteomicsDBi48466

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000267017; ENSP00000267017; ENSG00000139574 [O15130-1]
GeneIDi8620
KEGGihsa:8620
UCSCiuc001sdw.1 human [O15130-1]

Organism-specific databases

CTDi8620
DisGeNETi8620
EuPathDBiHostDB:ENSG00000139574.8
GeneCardsiNPFF
HGNCiHGNC:7901 NPFF
MIMi604643 gene
neXtProtiNX_O15130
OpenTargetsiENSG00000139574
PharmGKBiPA31704
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J2TH Eukaryota
ENOG410Z134 LUCA
GeneTreeiENSGT00390000015021
HOGENOMiHOG000113843
HOVERGENiHBG006519
InParanoidiO15130
KOiK05247
OMAiLIDQGCA
OrthoDBiEOG091G0YN1
PhylomeDBiO15130
TreeFamiTF330924

Enzyme and pathway databases

ReactomeiR-HSA-389397 Orexin and neuropeptides FF and QRFP bind to their respective receptors
R-HSA-416476 G alpha (q) signalling events
SIGNORiO15130

Miscellaneous databases

GeneWikiiNPFF
GenomeRNAii8620
PROiPR:O15130
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000139574 Expressed in 56 organ(s), highest expression level in cerebellum
CleanExiHS_NPFF
GenevisibleiO15130 HS

Family and domain databases

InterProiView protein in InterPro
IPR008065 NPFF
PANTHERiPTHR15044 PTHR15044, 1 hit
PfamiView protein in Pfam
PF15085 NPFF, 1 hit
PIRSFiPIRSF038092 FMRFamid-rel_pep_precur, 1 hit
PRINTSiPR01682 FMRFAMIDEPEP
ProtoNetiSearch...

Entry informationi

Entry nameiNPFF_HUMAN
AccessioniPrimary (citable) accession number: O15130
Secondary accession number(s): Q3SXL4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: November 7, 2018
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again