NPFF

Functionⁱ

Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels.1 Publication

GO - Molecular functionⁱ

G protein-coupled receptor binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
neuropeptide hormone activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
signaling receptor binding
Source: ProtInc
Traceable author statementⁱ
- 10851242
- 9224703

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

acute inflammatory response to antigenic stimulus Source: Ensembl
chemical synaptic transmission
Source: ProtInc
Traceable author statementⁱ
- 9224703
excitatory postsynaptic potential
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
G protein-coupled receptor signaling pathway Source: Reactome
maternal process involved in female pregnancy Source: Ensembl
negative regulation of appetite Source: Ensembl
negative regulation of heart rate Source: Ensembl
negative regulation of insulin secretion Source: Ensembl
neuropeptide signaling pathway
Source: ProtInc
Traceable author statementⁱ
- 10851242
positive regulation of blood pressure Source: Ensembl
positive regulation of cytosolic calcium ion concentration Source: Ensembl
regulation of membrane depolarization Source: Ensembl
regulation of sensory perception of pain Source: Ensembl
response to morphine Source: Ensembl
somatostatin secretion Source: Ensembl
spinal cord development Source: Ensembl
vasopressin secretion Source: Ensembl

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Neuropeptide

Molecular function

Neuropeptide

Enzyme and pathway databases

Reactomeⁱ	R-HSA-389397 Orexin and neuropeptides FF and QRFP bind to their respective receptors R-HSA-416476 G alpha (q) signalling events
SIGNORⁱ	O15130

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Pro-FMRFamide-related neuropeptide FF Alternative name(s): FMRFamide-related peptides Cleaved into the following 3 chains: Neuropeptide SF Short name: NPSF Neuropeptide FF Short name: NPFF Neuropeptide AF Short name: NPAF
Gene namesⁱ	Name:NPFF
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 12

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000139574.8
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:7901 NPFF
MIMⁱ	604643 gene
neXtProtⁱ	NX_O15130

Keywords - Cellular componentⁱ

Secreted

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	8620
Open Targets More...OpenTargetsⁱ	ENSG00000139574
PharmGKBⁱ	PA31704

Polymorphism and mutation databases

BioMutaⁱ	NPFF

BioMutaⁱ

NPFF

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Length
Signal peptideⁱ	1 – 20	Sequence analysisAdd BLAST	20
PropeptideⁱPRO_0000009898	21 – 65	Add BLAST	45
PeptideⁱPRO_0000009899	66 – 76	Neuropeptide SFAdd BLAST	11
PeptideⁱPRO_0000009900	69 – 76	Neuropeptide FF	8
PropeptideⁱPRO_0000009901	79 – 92	Add BLAST	14
PeptideⁱPRO_0000009902	93 – 110	Neuropeptide AFAdd BLAST	18

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	76	Phenylalanine amideBy similarity		1
Modified residueⁱ	110	Phenylalanine amideBy similarity		1

Keywords - PTMⁱ

Amidation, Cleavage on pair of basic residues

Proteomic databases

PaxDbⁱ	O15130
PRIDEⁱ	O15130
ProteomicsDBⁱ	48466

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000139574 Expressed in 56 organ(s), highest expression level in cerebellum
CleanExⁱ	HS_NPFF
Genevisibleⁱ	O15130 HS

Interactionⁱ

GO - Molecular functionⁱ

G protein-coupled receptor binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
neuropeptide hormone activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
signaling receptor binding
Source: ProtInc
Traceable author statementⁱ
- 10851242
- 9224703

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	114175, 1 interactor
IntActⁱ	O15130, 2 interactors
STRINGⁱ	9606.ENSP00000267017

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	O15130
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the FARP (FMRFamide related peptide) family.Curated

Keywords - Domainⁱ

Signal

Phylogenomic databases

eggNOGⁱ	ENOG410J2TH Eukaryota ENOG410Z134 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000015021
HOGENOMⁱ	HOG000113843
HOVERGENⁱ	HBG006519
InParanoidⁱ	O15130
KEGG Orthology (KO) More...KOⁱ	K05247
OMAⁱ	LIDQGCA
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0YN1
PhylomeDBⁱ	O15130
TreeFamⁱ	TF330924

Family and domain databases

InterProⁱ	View protein in InterPro IPR008065 NPFF
PANTHERⁱ	PTHR15044 PTHR15044, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF15085 NPFF, 1 hit
PIRSFⁱ	PIRSF038092 FMRFamid-rel_pep_precur, 1 hit
PRINTSⁱ	PR01682 FMRFAMIDEPEP

Sequences (2)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

Isoform 1 (identifier: O15130-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSRQAAALL VLLLLIDGGC AEGPGGQQED QLSAEEDSEP LPPQDAQTSG 
        60         70         80         90        100
SLLHYLLQAM ERPGRSQAFL FQPQRFGRNT QGSWRNEWLS PRAGEGLNSQ 
       110 
FWSLAAPQRF GKK

Length:113

Mass (Da):12,440

Last modified:January 1, 1998 - v1

Checksum:ⁱ1E9D4ED2A69238E3

GO

Isoform 2 (identifier: O15130-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-34: MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSA → MVPQPPTTCPWKPVPSPCDLRVQGICPSSFPDTPLAQ

« Hide

        10         20         30         40         50
MVPQPPTTCP WKPVPSPCDL RVQGICPSSF PDTPLAQEED SEPLPPQDAQ 
        60         70         80         90        100
TSGSLLHYLL QAMERPGRSQ AFLFQPQRFG RNTQGSWRNE WLSPRAGEGL 
       110 
NSQFWSLAAP QRFGKK

Note: No experimental confirmation available.

Show »

Length:116

Mass (Da):12,991

Checksum:ⁱ0E1EB094309C3105

GO

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_049183	88	W → R. Corresponds to variant dbSNP:rs35822762Ensembl.		1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_056475	1 – 34	MDSRQ…DQLSA → MVPQPPTTCPWKPVPSPCDL RVQGICPSSFPDTPLAQ in isoform 2. 1 PublicationAdd BLAST		34

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF005271 mRNA Translation: AAB64288.1 AC023509 Genomic DNA No translation available. CH471054 Genomic DNA Translation: EAW96721.1 BC104234 mRNA Translation: AAI04235.1 BC104235 mRNA Translation: AAI04236.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS8862.1 [O15130-1]
NCBI Reference Sequences More...RefSeqⁱ	NP_001307225.1, NM_001320296.1 [O15130-2] NP_003708.1, NM_003717.3 [O15130-1]
UniGeneⁱ	Hs.733076

Genome annotation databases

Ensemblⁱ	ENST00000267017; ENSP00000267017; ENSG00000139574 [O15130-1]
GeneIDⁱ	8620
KEGGⁱ	hsa:8620
UCSC genome browser More...UCSCⁱ	uc001sdw.1 human [O15130-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O15130	Uncharacterized protein		MACMU		113	UniRef90_O15130
Uncharacterized protein		MACFA		113
Uncharacterized protein		COLAP		113
Uncharacterized protein		PONAB		113
Neuropeptide FF-amide peptide precursor		PANTR		113
+12
O15130-2	Uncharacterized protein		MACMU		116	UniRef90_O15130-2
Uncharacterized protein		MACFA		116
UPI0000E2311C		PANPA		116
UPI00045DB391		CHLSB		116
UPI0004F1FBED		PAPAN		116
+9

Protein	Similar proteins		Species	Score	Length	Source
O15130	Pro-FMRFamide-related neuropeptide FF		RAT		114	UniRef50_Q9WVA9
Pro-FMRFamide-related neuropeptide FF		MOUSE		114
FMRFamide-related peptides preproprotein		CALJA		117
Neuropeptide FF-amide peptide precursor		SAIBB		115
Uncharacterized protein		AOTNA		109
+64

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF005271 mRNA Translation: AAB64288.1 AC023509 Genomic DNA No translation available. CH471054 Genomic DNA Translation: EAW96721.1 BC104234 mRNA Translation: AAI04235.1 BC104235 mRNA Translation: AAI04236.1
CCDSⁱ	CCDS8862.1 [O15130-1]
RefSeqⁱ	NP_001307225.1, NM_001320296.1 [O15130-2] NP_003708.1, NM_003717.3 [O15130-1]
UniGeneⁱ	Hs.733076

3D structure databases

ProteinModelPortalⁱ	O15130
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	114175, 1 interactor
IntActⁱ	O15130, 2 interactors
STRINGⁱ	9606.ENSP00000267017

Polymorphism and mutation databases

BioMutaⁱ	NPFF

BioMutaⁱ

NPFF

Proteomic databases

PaxDbⁱ	O15130
PRIDEⁱ	O15130
ProteomicsDBⁱ	48466

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000267017; ENSP00000267017; ENSG00000139574 [O15130-1]
GeneIDⁱ	8620
KEGGⁱ	hsa:8620
UCSCⁱ	uc001sdw.1 human [O15130-1]

Organism-specific databases

CTDⁱ	8620
DisGeNETⁱ	8620
EuPathDBⁱ	HostDB:ENSG00000139574.8
GeneCardsⁱ	NPFF
HGNCⁱ	HGNC:7901 NPFF
MIMⁱ	604643 gene
neXtProtⁱ	NX_O15130
OpenTargetsⁱ	ENSG00000139574
PharmGKBⁱ	PA31704
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410J2TH Eukaryota ENOG410Z134 LUCA
GeneTreeⁱ	ENSGT00390000015021
HOGENOMⁱ	HOG000113843
HOVERGENⁱ	HBG006519
InParanoidⁱ	O15130
KOⁱ	K05247
OMAⁱ	LIDQGCA
OrthoDBⁱ	EOG091G0YN1
PhylomeDBⁱ	O15130
TreeFamⁱ	TF330924

Enzyme and pathway databases

Reactomeⁱ	R-HSA-389397 Orexin and neuropeptides FF and QRFP bind to their respective receptors R-HSA-416476 G alpha (q) signalling events
SIGNORⁱ	O15130

Miscellaneous databases

GeneWikiⁱ	NPFF
GenomeRNAiⁱ	8620
Protein Ontology More...PROⁱ	PR:O15130
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000139574 Expressed in 56 organ(s), highest expression level in cerebellum
CleanExⁱ	HS_NPFF
Genevisibleⁱ	O15130 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR008065 NPFF
PANTHERⁱ	PTHR15044 PTHR15044, 1 hit
Pfamⁱ	View protein in Pfam PF15085 NPFF, 1 hit
PIRSFⁱ	PIRSF038092 FMRFamid-rel_pep_precur, 1 hit
PRINTSⁱ	PR01682 FMRFAMIDEPEP
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	NPFF_HUMAN
Accessionⁱ	O15130Primary (citable) accession number: O15130 Secondary accession number(s): Q3SXL4
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 30, 2000
	Last sequence update:	January 1, 1998
	Last modified:	November 7, 2018
	This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human chromosome 12
Human chromosome 12: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O15130 (NPFF_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Pro-FMRFamide-related neuropeptide FF

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted

Extracellular region or secreted

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ