Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FYN-binding protein 1

Gene

FYB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as an adapter protein of the FYN and LCP2 signaling cascades in T-cells. Modulates the expression of interleukin-2 (IL-2). Involved in platelet activation. Prevents the degradation of SKAP1 and SKAP2. May play a role in linking T-cell signaling to remodeling of the actin cytoskeleton.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • lipid binding Source: InterPro
  • protein-containing complex binding Source: Ensembl
  • signaling receptor binding Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-202433 Generation of second messenger molecules
R-HSA-391160 Signal regulatory protein family interactions

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O15117

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O15117

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
FYN-binding protein 1Combined sources
Alternative name(s):
Adhesion and degranulation promoting adaptor protein
Short name:
ADAP
FYB-120/130
Short name:
p120/p130
FYN-T-binding protein
SLAP-130
SLP-76-associated phosphoprotein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FYB1Combined sources
Synonyms:FYB, SLAP130
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000082074.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:4036 FYB1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602731 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15117

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Thrombocytopenia 3 (THC3)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionThrombocytopenia is defined by a decrease in the number of platelets in circulating blood, resulting in the potential for increased bleeding and decreased ability for clotting. THC3 is an autosomal recessive form characterized by onset in infancy.
See also OMIM:273900
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_078810131 – 783Missing in THC3. 1 PublicationAdd BLAST653

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
2533

MalaCards human disease database

More...
MalaCardsi
FYB1
MIMi273900 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000082074

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28452

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FYB1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000873961 – 783FYN-binding protein 1Add BLAST783

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei3N6-acetyllysineCombined sources1
Modified residuei28PhosphoserineBy similarity1
Modified residuei46PhosphoserineCombined sources1
Modified residuei225PhosphoserineCombined sources1
Modified residuei329PhosphoserineCombined sources1
Modified residuei457PhosphoserineCombined sources1
Modified residuei571PhosphotyrosineCombined sources1
Modified residuei573PhosphoserineCombined sources1
Modified residuei580PhosphoserineBy similarity1
Modified residuei651PhosphotyrosineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

T-cell receptor ligation leads to increased tyrosine phosphorylation.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O15117

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O15117

PeptideAtlas

More...
PeptideAtlasi
O15117

PRoteomics IDEntifications database

More...
PRIDEi
O15117

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48451
48452 [O15117-2]

2D gel databases

USC-OGP 2-DE database

More...
OGPi
O15117

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15117

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15117

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
O15117

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in hematopoietic tissues such as myeloid and T-cells, spleen and thymus. Not expressed in B-cells, nor in non-lymphoid tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000082074 Expressed in 205 organ(s), highest expression level in blood

CleanEx database of gene expression profiles

More...
CleanExi
HS_FYB

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O15117 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15117 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB025336
HPA026796

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of a complex consisting of SKAP2, FYB1 and PTPNS1. Part of a complex consisting of SKAP2, FYB1 and LILRB3 (By similarity). Interacts with FYN (PubMed:27335501, PubMed:9207119, PubMed:10942756, PubMed:15849195). Interacts with LCP2 (PubMed:27335501, PubMed:9207119, PubMed:10942756). Interacts with SKAP1 (PubMed:27335501, PubMed:9755858, PubMed:9748251, PubMed:9671755, PubMed:10856234, PubMed:15849195, PubMed:16461356). Interacts with SKAP2 (PubMed:9755858, PubMed:9671755). Interacts with FASLG (PubMed:19807924). Interacts with EVL (PubMed:10747096). Interacts with TMEM47 (By similarity). Interacts with LCK (PubMed:27335501).By similarity11 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108809, 14 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O15117

Database of interacting proteins

More...
DIPi
DIP-42204N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
O15117

Protein interaction database and analysis system

More...
IntActi
O15117, 26 interactors

Molecular INTeraction database

More...
MINTi
O15117

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1783
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RI9NMR-A683-771[»]
2GTJNMR-A486-579[»]
2GTONMR-A486-579[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O15117

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O15117

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O15117

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini511 – 572SH3 1PROSITE-ProRule annotationAdd BLAST62
Domaini700 – 768SH3 2PROSITE-ProRule annotationAdd BLAST69

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni348 – 448Interaction with SKAP1Add BLAST101

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili456 – 507Sequence analysisAdd BLAST52

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi462 – 465SH2-bindingSequence analysis4
Motifi469 – 505Nuclear localization signalSequence analysisAdd BLAST37
Motifi595 – 598SH2-binding; to LCP24
Motifi625 – 628SH2-binding; to FYN4
Motifi674 – 700Nuclear localization signalSequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi355 – 360Poly-Pro6
Compositional biasi393 – 397Poly-Pro5
Compositional biasi617 – 620Poly-Pro4

Keywords - Domaini

Coiled coil, Repeat, SH3 domain

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063460

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000008686

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG005774

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15117

KEGG Orthology (KO)

More...
KOi
K17698

Identification of Orthologs from Complete Genome Data

More...
OMAi
HQAKACC

Database of Orthologous Groups

More...
OrthoDBi
831692at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O15117

TreeFam database of animal gene trees

More...
TreeFami
TF337003

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11867 hSH3_ADAP, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030635 FYB
IPR035540 FYB_hSH3
IPR029294 hSH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

The PANTHER Classification System

More...
PANTHERi
PTHR16830:SF13 PTHR16830:SF13, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14603 hSH3, 1 hit
PF07653 SH3_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform FYB-120 (identifier: O15117-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKYNTGGNP TEDVSVNSRP FRVTGPNSSS GIQARKNLFN NQGNASPPAG
60 70 80 90 100
PSNVPKFGSP KPPVAVKPSS EEKPDKEPKP PFLKPTGAGQ RFGTPASLTT
110 120 130 140 150
RDPEAKVGFL KPVGPKPINL PKEDSKPTFP WPPGNKPSLH SVNQDHDLKP
160 170 180 190 200
LGPKSGPTPP TSENEQKQAF PKLTGVKGKF MSASQDLEPK PLFPKPAFGQ
210 220 230 240 250
KPPLSTENSH EDESPMKNVS SSKGSPAPLG VRSKSGPLKP AREDSENKDH
260 270 280 290 300
AGEISSLPFP GVVLKPAASR GGPGLSKNGE EKKEDRKIDA AKNTFQSKIN
310 320 330 340 350
QEELASGTPP ARFPKAPSKL TVGGPWGQSQ EKEKGDKNSA TPKQKPLPPL
360 370 380 390 400
FTLGPPPPKP NRPPNVDLTK FHKTSSGNST SKGQTSYSTT SLPPPPPSHP
410 420 430 440 450
ASQPPLPASH PSQPPVPSLP PRNIKPPFDL KSPVNEDNQD GVTHSDGAGN
460 470 480 490 500
LDEEQDSEGE TYEDIEASKE REKKREKEEK KRLELEKKEQ KEKEKKEQEI
510 520 530 540 550
KKKFKLTGPI QVIHLAKACC DVKGGKNELS FKQGEQIEII RITDNPEGKW
560 570 580 590 600
LGRTARGSYG YIKTTAVEID YDSLKLKKDS LGAPSRPIED DQEVYDDVAE
610 620 630 640 650
QDDISSHSQS GSGGIFPPPP DDDIYDGIEE EDADDGFPAP PKQLDMGDEV
660 670 680 690 700
YDDVDTSDFP VSSAEMSQGT NVGKAKTEEK DLKKLKKQEK EEKDFRKKFK
710 720 730 740 750
YDGEIRVLYS TKVTTSITSK KWGTRDLQVK PGESLEVIQT TDDTKVLCRN
760 770 780
EEGKYGYVLR SYLADNDGEI YDDIADGCIY DND
Length:783
Mass (Da):85,387
Last modified:November 24, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4EE28EF12AA0E457
GO
Isoform FYB-130 (identifier: O15117-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     636-636: G → GSTLQVQEKSNTWSWGILKMLKGKDDRKKSIREKPKVSDSDNNEGSS

Show »
Length:829
Mass (Da):90,606
Checksum:iBDDEE1977674BC65
GO
Isoform 3 (identifier: O15117-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDGKADVKSLM
     636-636: G → GSTLQVQEKSNTWSWGILKMLKGKDDRKKSIREKPKVSDSDNNEGSS

Note: No experimental confirmation available.
Show »
Length:839
Mass (Da):91,651
Checksum:i3EB9A0C1FF816B6B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RFJ5D6RFJ5_HUMAN
FYN-binding protein 1
FYB1
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RER7D6RER7_HUMAN
FYN-binding protein 1
FYB1
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAE8D6RAE8_HUMAN
FYN-binding protein 1
FYB1
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YEE1A0A2R8YEE1_HUMAN
FYN-binding protein 1
FYB1
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RC38D6RC38_HUMAN
FYN-binding protein 1
FYB1
22Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti27N → S in BAF83092 (PubMed:14702039).Curated1
Sequence conflicti273P → L in AAC51300 (PubMed:9115214).Curated1
Sequence conflicti275L → V in AAB62226 (PubMed:9207119).Curated1
Sequence conflicti541R → C in BAF83092 (PubMed:14702039).Curated1
Sequence conflicti674K → E in BAF83092 (PubMed:14702039).Curated1
Sequence conflicti729V → A in BAF83092 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05688051P → L. Corresponds to variant dbSNP:rs1642515Ensembl.1
Natural variantiVAR_078810131 – 783Missing in THC3. 1 PublicationAdd BLAST653
Natural variantiVAR_056881332K → R. Corresponds to variant dbSNP:rs3749741Ensembl.1
Natural variantiVAR_060592672V → FCombined sources5 PublicationsCorresponds to variant dbSNP:rs379707Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0472881M → MDGKADVKSLM in isoform 3. 1 Publication1
Alternative sequenceiVSP_042309636G → GSTLQVQEKSNTWSWGILKM LKGKDDRKKSIREKPKVSDS DNNEGSS in isoform FYB-130 and isoform 3. 3 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF001862 mRNA Translation: AAB62226.1
U93049 mRNA Translation: AAC51300.1
AF198052 mRNA Translation: AAF62400.1
AK290403 mRNA Translation: BAF83092.1
AK297077 mRNA Translation: BAG59594.1
AC008964 Genomic DNA No translation available.
AC010633 Genomic DNA No translation available.
AC025471 Genomic DNA No translation available.
CH471119 Genomic DNA Translation: EAW55984.1
BC117449 mRNA Translation: AAI17450.1
BC143645 mRNA Translation: AAI43646.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47200.1 [O15117-1]
CCDS54848.1 [O15117-2]
CCDS58945.1 [O15117-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001230022.1, NM_001243093.1 [O15117-3]
NP_001456.3, NM_001465.4 [O15117-2]
NP_955367.1, NM_199335.3 [O15117-1]
XP_006714527.1, XM_006714464.2 [O15117-2]
XP_006714528.1, XM_006714465.2
XP_006714529.1, XM_006714466.2 [O15117-2]
XP_011512310.1, XM_011514008.2 [O15117-3]
XP_011512311.1, XM_011514009.1 [O15117-2]
XP_011512312.1, XM_011514010.1 [O15117-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.370503
Hs.691768

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000351578; ENSP00000316460; ENSG00000082074 [O15117-1]
ENST00000505428; ENSP00000427114; ENSG00000082074 [O15117-2]
ENST00000512982; ENSP00000425845; ENSG00000082074 [O15117-3]
ENST00000515010; ENSP00000426346; ENSG00000082074 [O15117-1]
ENST00000646045; ENSP00000493623; ENSG00000082074 [O15117-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2533

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2533

UCSC genome browser

More...
UCSCi
uc003jls.4 human [O15117-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF001862 mRNA Translation: AAB62226.1
U93049 mRNA Translation: AAC51300.1
AF198052 mRNA Translation: AAF62400.1
AK290403 mRNA Translation: BAF83092.1
AK297077 mRNA Translation: BAG59594.1
AC008964 Genomic DNA No translation available.
AC010633 Genomic DNA No translation available.
AC025471 Genomic DNA No translation available.
CH471119 Genomic DNA Translation: EAW55984.1
BC117449 mRNA Translation: AAI17450.1
BC143645 mRNA Translation: AAI43646.1
CCDSiCCDS47200.1 [O15117-1]
CCDS54848.1 [O15117-2]
CCDS58945.1 [O15117-3]
RefSeqiNP_001230022.1, NM_001243093.1 [O15117-3]
NP_001456.3, NM_001465.4 [O15117-2]
NP_955367.1, NM_199335.3 [O15117-1]
XP_006714527.1, XM_006714464.2 [O15117-2]
XP_006714528.1, XM_006714465.2
XP_006714529.1, XM_006714466.2 [O15117-2]
XP_011512310.1, XM_011514008.2 [O15117-3]
XP_011512311.1, XM_011514009.1 [O15117-2]
XP_011512312.1, XM_011514010.1 [O15117-2]
UniGeneiHs.370503
Hs.691768

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RI9NMR-A683-771[»]
2GTJNMR-A486-579[»]
2GTONMR-A486-579[»]
ProteinModelPortaliO15117
SMRiO15117
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108809, 14 interactors
CORUMiO15117
DIPiDIP-42204N
ELMiO15117
IntActiO15117, 26 interactors
MINTiO15117

PTM databases

iPTMnetiO15117
PhosphoSitePlusiO15117

Polymorphism and mutation databases

BioMutaiFYB1

2D gel databases

OGPiO15117

Proteomic databases

jPOSTiO15117
MaxQBiO15117
PeptideAtlasiO15117
PRIDEiO15117
ProteomicsDBi48451
48452 [O15117-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000351578; ENSP00000316460; ENSG00000082074 [O15117-1]
ENST00000505428; ENSP00000427114; ENSG00000082074 [O15117-2]
ENST00000512982; ENSP00000425845; ENSG00000082074 [O15117-3]
ENST00000515010; ENSP00000426346; ENSG00000082074 [O15117-1]
ENST00000646045; ENSP00000493623; ENSG00000082074 [O15117-3]
GeneIDi2533
KEGGihsa:2533
UCSCiuc003jls.4 human [O15117-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2533
DisGeNETi2533
EuPathDBiHostDB:ENSG00000082074.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FYB1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0024785
HGNCiHGNC:4036 FYB1
HPAiCAB025336
HPA026796
MalaCardsiFYB1
MIMi273900 phenotype
602731 gene
neXtProtiNX_O15117
OpenTargetsiENSG00000082074
PharmGKBiPA28452

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00530000063460
HOGENOMiHOG000008686
HOVERGENiHBG005774
InParanoidiO15117
KOiK17698
OMAiHQAKACC
OrthoDBi831692at2759
PhylomeDBiO15117
TreeFamiTF337003

Enzyme and pathway databases

ReactomeiR-HSA-202433 Generation of second messenger molecules
R-HSA-391160 Signal regulatory protein family interactions
SignaLinkiO15117
SIGNORiO15117

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FYB human
EvolutionaryTraceiO15117

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FYB

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2533
PMAP-CutDBiO15117

Protein Ontology

More...
PROi
PR:O15117

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000082074 Expressed in 205 organ(s), highest expression level in blood
CleanExiHS_FYB
ExpressionAtlasiO15117 baseline and differential
GenevisibleiO15117 HS

Family and domain databases

CDDicd11867 hSH3_ADAP, 1 hit
InterProiView protein in InterPro
IPR030635 FYB
IPR035540 FYB_hSH3
IPR029294 hSH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR16830:SF13 PTHR16830:SF13, 2 hits
PfamiView protein in Pfam
PF14603 hSH3, 1 hit
PF07653 SH3_2, 1 hit
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 2 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFYB1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15117
Secondary accession number(s): A8K2Y8
, B4DLN2, E9PBV9, O00359, Q9NZI9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 24, 2009
Last modified: January 16, 2019
This is version 180 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again