Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FYN-binding protein 1

Gene

FYB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as an adapter protein of the FYN and LCP2 signaling cascades in T-cells. Modulates the expression of interleukin-2 (IL-2). Involved in platelet activation. Prevents the degradation of SKAP1 and SKAP2. May play a role in linking T-cell signaling to remodeling of the actin cytoskeleton.3 Publications

GO - Molecular functioni

  • lipid binding Source: InterPro
  • protein-containing complex binding Source: Ensembl
  • signaling receptor binding Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-202433 Generation of second messenger molecules
R-HSA-391160 Signal regulatory protein family interactions
SignaLinkiO15117
SIGNORiO15117

Names & Taxonomyi

Protein namesi
Recommended name:
FYN-binding protein 1Combined sources
Alternative name(s):
Adhesion and degranulation promoting adaptor protein
Short name:
ADAP
FYB-120/130
Short name:
p120/p130
FYN-T-binding protein
SLAP-130
SLP-76-associated phosphoprotein
Gene namesi
Name:FYB1Combined sources
Synonyms:FYB, SLAP130
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000082074.15
HGNCiHGNC:4036 FYB1
MIMi602731 gene
neXtProtiNX_O15117

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

Thrombocytopenia 3 (THC3)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionThrombocytopenia is defined by a decrease in the number of platelets in circulating blood, resulting in the potential for increased bleeding and decreased ability for clotting. THC3 is an autosomal recessive form characterized by onset in infancy.
See also OMIM:273900
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_078810131 – 783Missing in THC3. 1 PublicationAdd BLAST653

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi2533
MalaCardsiFYB1
MIMi273900 phenotype
OpenTargetsiENSG00000082074
PharmGKBiPA28452

Polymorphism and mutation databases

BioMutaiFYB

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000873961 – 783FYN-binding protein 1Add BLAST783

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei3N6-acetyllysineCombined sources1
Modified residuei28PhosphoserineBy similarity1
Modified residuei46PhosphoserineCombined sources1
Modified residuei225PhosphoserineCombined sources1
Modified residuei329PhosphoserineCombined sources1
Modified residuei457PhosphoserineCombined sources1
Modified residuei571PhosphotyrosineCombined sources1
Modified residuei573PhosphoserineCombined sources1
Modified residuei580PhosphoserineBy similarity1
Modified residuei651PhosphotyrosineCombined sources1

Post-translational modificationi

T-cell receptor ligation leads to increased tyrosine phosphorylation.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiO15117
PeptideAtlasiO15117
PRIDEiO15117
ProteomicsDBi48451
48452 [O15117-2]

2D gel databases

OGPiO15117

PTM databases

iPTMnetiO15117
PhosphoSitePlusiO15117

Miscellaneous databases

PMAP-CutDBiO15117

Expressioni

Tissue specificityi

Expressed in hematopoietic tissues such as myeloid and T-cells, spleen and thymus. Not expressed in B-cells, nor in non-lymphoid tissues.

Gene expression databases

BgeeiENSG00000082074 Expressed in 205 organ(s), highest expression level in blood
CleanExiHS_FYB
ExpressionAtlasiO15117 baseline and differential
GenevisibleiO15117 HS

Organism-specific databases

HPAiCAB025336
HPA026796

Interactioni

Subunit structurei

Part of a complex consisting of SKAP2, FYB1 and PTPNS1. Part of a complex consisting of SKAP2, FYB1 and LILRB3 (By similarity). Interacts with FYN (PubMed:27335501, PubMed:9207119, PubMed:10942756, PubMed:15849195). Interacts with LCP2 (PubMed:27335501, PubMed:9207119, PubMed:10942756). Interacts with SKAP1 (PubMed:27335501, PubMed:9755858, PubMed:9748251, PubMed:9671755, PubMed:10856234, PubMed:15849195, PubMed:16461356). Interacts with SKAP2 (PubMed:9755858, PubMed:9671755). Interacts with FASLG (PubMed:19807924). Interacts with EVL (PubMed:10747096). Interacts with TMEM47 (By similarity). Interacts with LCK (PubMed:27335501).By similarity11 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi108809, 14 interactors
CORUMiO15117
DIPiDIP-42204N
ELMiO15117
IntActiO15117, 26 interactors
MINTiO15117

Structurei

Secondary structure

1783
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO15117
SMRiO15117
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15117

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini511 – 572SH3 1PROSITE-ProRule annotationAdd BLAST62
Domaini700 – 768SH3 2PROSITE-ProRule annotationAdd BLAST69

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni348 – 448Interaction with SKAP1Add BLAST101

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili456 – 507Sequence analysisAdd BLAST52

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi462 – 465SH2-bindingSequence analysis4
Motifi469 – 505Nuclear localization signalSequence analysisAdd BLAST37
Motifi595 – 598SH2-binding; to LCP24
Motifi625 – 628SH2-binding; to FYN4
Motifi674 – 700Nuclear localization signalSequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi355 – 360Poly-Pro6
Compositional biasi393 – 397Poly-Pro5
Compositional biasi617 – 620Poly-Pro4

Keywords - Domaini

Coiled coil, Repeat, SH3 domain

Phylogenomic databases

GeneTreeiENSGT00530000063460
HOGENOMiHOG000008686
HOVERGENiHBG005774
InParanoidiO15117
KOiK17698
OMAiHQAKACC
OrthoDBiEOG091G04X1
PhylomeDBiO15117
TreeFamiTF337003

Family and domain databases

CDDicd11867 hSH3_ADAP, 1 hit
InterProiView protein in InterPro
IPR030635 FYB
IPR035540 FYB_hSH3
IPR029294 hSH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR16830:SF13 PTHR16830:SF13, 2 hits
PfamiView protein in Pfam
PF14603 hSH3, 1 hit
PF07653 SH3_2, 1 hit
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 2 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 2 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform FYB-120 (identifier: O15117-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKYNTGGNP TEDVSVNSRP FRVTGPNSSS GIQARKNLFN NQGNASPPAG
60 70 80 90 100
PSNVPKFGSP KPPVAVKPSS EEKPDKEPKP PFLKPTGAGQ RFGTPASLTT
110 120 130 140 150
RDPEAKVGFL KPVGPKPINL PKEDSKPTFP WPPGNKPSLH SVNQDHDLKP
160 170 180 190 200
LGPKSGPTPP TSENEQKQAF PKLTGVKGKF MSASQDLEPK PLFPKPAFGQ
210 220 230 240 250
KPPLSTENSH EDESPMKNVS SSKGSPAPLG VRSKSGPLKP AREDSENKDH
260 270 280 290 300
AGEISSLPFP GVVLKPAASR GGPGLSKNGE EKKEDRKIDA AKNTFQSKIN
310 320 330 340 350
QEELASGTPP ARFPKAPSKL TVGGPWGQSQ EKEKGDKNSA TPKQKPLPPL
360 370 380 390 400
FTLGPPPPKP NRPPNVDLTK FHKTSSGNST SKGQTSYSTT SLPPPPPSHP
410 420 430 440 450
ASQPPLPASH PSQPPVPSLP PRNIKPPFDL KSPVNEDNQD GVTHSDGAGN
460 470 480 490 500
LDEEQDSEGE TYEDIEASKE REKKREKEEK KRLELEKKEQ KEKEKKEQEI
510 520 530 540 550
KKKFKLTGPI QVIHLAKACC DVKGGKNELS FKQGEQIEII RITDNPEGKW
560 570 580 590 600
LGRTARGSYG YIKTTAVEID YDSLKLKKDS LGAPSRPIED DQEVYDDVAE
610 620 630 640 650
QDDISSHSQS GSGGIFPPPP DDDIYDGIEE EDADDGFPAP PKQLDMGDEV
660 670 680 690 700
YDDVDTSDFP VSSAEMSQGT NVGKAKTEEK DLKKLKKQEK EEKDFRKKFK
710 720 730 740 750
YDGEIRVLYS TKVTTSITSK KWGTRDLQVK PGESLEVIQT TDDTKVLCRN
760 770 780
EEGKYGYVLR SYLADNDGEI YDDIADGCIY DND
Length:783
Mass (Da):85,387
Last modified:November 24, 2009 - v2
Checksum:i4EE28EF12AA0E457
GO
Isoform FYB-130 (identifier: O15117-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     636-636: G → GSTLQVQEKSNTWSWGILKMLKGKDDRKKSIREKPKVSDSDNNEGSS

Show »
Length:829
Mass (Da):90,606
Checksum:iBDDEE1977674BC65
GO
Isoform 3 (identifier: O15117-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDGKADVKSLM
     636-636: G → GSTLQVQEKSNTWSWGILKMLKGKDDRKKSIREKPKVSDSDNNEGSS

Note: No experimental confirmation available.
Show »
Length:839
Mass (Da):91,651
Checksum:i3EB9A0C1FF816B6B
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RFJ5D6RFJ5_HUMAN
FYN-binding protein 1
FYB1
174Annotation score:
D6RER7D6RER7_HUMAN
FYN-binding protein 1
FYB1
114Annotation score:
D6RAE8D6RAE8_HUMAN
FYN-binding protein 1
FYB1
62Annotation score:
A0A2R8YEE1A0A2R8YEE1_HUMAN
FYN-binding protein 1
FYB1
69Annotation score:
D6RC38D6RC38_HUMAN
FYN-binding protein 1
FYB1
22Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti27N → S in BAF83092 (PubMed:14702039).Curated1
Sequence conflicti273P → L in AAC51300 (PubMed:9115214).Curated1
Sequence conflicti275L → V in AAB62226 (PubMed:9207119).Curated1
Sequence conflicti541R → C in BAF83092 (PubMed:14702039).Curated1
Sequence conflicti674K → E in BAF83092 (PubMed:14702039).Curated1
Sequence conflicti729V → A in BAF83092 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05688051P → L. Corresponds to variant dbSNP:rs1642515Ensembl.1
Natural variantiVAR_078810131 – 783Missing in THC3. 1 PublicationAdd BLAST653
Natural variantiVAR_056881332K → R. Corresponds to variant dbSNP:rs3749741Ensembl.1
Natural variantiVAR_060592672V → FCombined sources5 PublicationsCorresponds to variant dbSNP:rs379707Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0472881M → MDGKADVKSLM in isoform 3. 1 Publication1
Alternative sequenceiVSP_042309636G → GSTLQVQEKSNTWSWGILKM LKGKDDRKKSIREKPKVSDS DNNEGSS in isoform FYB-130 and isoform 3. 3 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF001862 mRNA Translation: AAB62226.1
U93049 mRNA Translation: AAC51300.1
AF198052 mRNA Translation: AAF62400.1
AK290403 mRNA Translation: BAF83092.1
AK297077 mRNA Translation: BAG59594.1
AC008964 Genomic DNA No translation available.
AC010633 Genomic DNA No translation available.
AC025471 Genomic DNA No translation available.
CH471119 Genomic DNA Translation: EAW55984.1
BC117449 mRNA Translation: AAI17450.1
BC143645 mRNA Translation: AAI43646.1
CCDSiCCDS47200.1 [O15117-1]
CCDS54848.1 [O15117-2]
CCDS58945.1 [O15117-3]
RefSeqiNP_001230022.1, NM_001243093.1 [O15117-3]
NP_001456.3, NM_001465.4 [O15117-2]
NP_955367.1, NM_199335.3 [O15117-1]
XP_006714527.1, XM_006714464.2 [O15117-2]
XP_006714528.1, XM_006714465.2
XP_006714529.1, XM_006714466.2 [O15117-2]
XP_011512310.1, XM_011514008.2 [O15117-3]
XP_011512311.1, XM_011514009.1 [O15117-2]
XP_011512312.1, XM_011514010.1 [O15117-2]
UniGeneiHs.370503
Hs.691768

Genome annotation databases

EnsembliENST00000351578; ENSP00000316460; ENSG00000082074 [O15117-1]
ENST00000505428; ENSP00000427114; ENSG00000082074 [O15117-2]
ENST00000512982; ENSP00000425845; ENSG00000082074 [O15117-3]
ENST00000515010; ENSP00000426346; ENSG00000082074 [O15117-1]
ENST00000646045; ENSP00000493623; ENSG00000082074 [O15117-3]
GeneIDi2533
KEGGihsa:2533
UCSCiuc003jls.4 human [O15117-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF001862 mRNA Translation: AAB62226.1
U93049 mRNA Translation: AAC51300.1
AF198052 mRNA Translation: AAF62400.1
AK290403 mRNA Translation: BAF83092.1
AK297077 mRNA Translation: BAG59594.1
AC008964 Genomic DNA No translation available.
AC010633 Genomic DNA No translation available.
AC025471 Genomic DNA No translation available.
CH471119 Genomic DNA Translation: EAW55984.1
BC117449 mRNA Translation: AAI17450.1
BC143645 mRNA Translation: AAI43646.1
CCDSiCCDS47200.1 [O15117-1]
CCDS54848.1 [O15117-2]
CCDS58945.1 [O15117-3]
RefSeqiNP_001230022.1, NM_001243093.1 [O15117-3]
NP_001456.3, NM_001465.4 [O15117-2]
NP_955367.1, NM_199335.3 [O15117-1]
XP_006714527.1, XM_006714464.2 [O15117-2]
XP_006714528.1, XM_006714465.2
XP_006714529.1, XM_006714466.2 [O15117-2]
XP_011512310.1, XM_011514008.2 [O15117-3]
XP_011512311.1, XM_011514009.1 [O15117-2]
XP_011512312.1, XM_011514010.1 [O15117-2]
UniGeneiHs.370503
Hs.691768

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RI9NMR-A683-771[»]
2GTJNMR-A486-579[»]
2GTONMR-A486-579[»]
ProteinModelPortaliO15117
SMRiO15117
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108809, 14 interactors
CORUMiO15117
DIPiDIP-42204N
ELMiO15117
IntActiO15117, 26 interactors
MINTiO15117

PTM databases

iPTMnetiO15117
PhosphoSitePlusiO15117

Polymorphism and mutation databases

BioMutaiFYB

2D gel databases

OGPiO15117

Proteomic databases

MaxQBiO15117
PeptideAtlasiO15117
PRIDEiO15117
ProteomicsDBi48451
48452 [O15117-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000351578; ENSP00000316460; ENSG00000082074 [O15117-1]
ENST00000505428; ENSP00000427114; ENSG00000082074 [O15117-2]
ENST00000512982; ENSP00000425845; ENSG00000082074 [O15117-3]
ENST00000515010; ENSP00000426346; ENSG00000082074 [O15117-1]
ENST00000646045; ENSP00000493623; ENSG00000082074 [O15117-3]
GeneIDi2533
KEGGihsa:2533
UCSCiuc003jls.4 human [O15117-1]

Organism-specific databases

CTDi2533
DisGeNETi2533
EuPathDBiHostDB:ENSG00000082074.15
GeneCardsiFYB1
H-InvDBiHIX0024785
HGNCiHGNC:4036 FYB1
HPAiCAB025336
HPA026796
MalaCardsiFYB1
MIMi273900 phenotype
602731 gene
neXtProtiNX_O15117
OpenTargetsiENSG00000082074
PharmGKBiPA28452
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063460
HOGENOMiHOG000008686
HOVERGENiHBG005774
InParanoidiO15117
KOiK17698
OMAiHQAKACC
OrthoDBiEOG091G04X1
PhylomeDBiO15117
TreeFamiTF337003

Enzyme and pathway databases

ReactomeiR-HSA-202433 Generation of second messenger molecules
R-HSA-391160 Signal regulatory protein family interactions
SignaLinkiO15117
SIGNORiO15117

Miscellaneous databases

ChiTaRSiFYB human
EvolutionaryTraceiO15117
GeneWikiiFYB
GenomeRNAii2533
PMAP-CutDBiO15117
PROiPR:O15117
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000082074 Expressed in 205 organ(s), highest expression level in blood
CleanExiHS_FYB
ExpressionAtlasiO15117 baseline and differential
GenevisibleiO15117 HS

Family and domain databases

CDDicd11867 hSH3_ADAP, 1 hit
InterProiView protein in InterPro
IPR030635 FYB
IPR035540 FYB_hSH3
IPR029294 hSH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR16830:SF13 PTHR16830:SF13, 2 hits
PfamiView protein in Pfam
PF14603 hSH3, 1 hit
PF07653 SH3_2, 1 hit
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 2 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiFYB1_HUMAN
AccessioniPrimary (citable) accession number: O15117
Secondary accession number(s): A8K2Y8
, B4DLN2, E9PBV9, O00359, Q9NZI9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 24, 2009
Last modified: November 7, 2018
This is version 178 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again