Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 185 (16 Oct 2019)
Sequence version 1 (01 Jan 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Rho guanine nucleotide exchange factor 11

Gene

ARHGEF11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13. Involved in neurotrophin-induced neurite outgrowth.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation, Guanine-nucleotide releasing factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events
R-HSA-416572 Sema4D induced cell migration and growth-cone collapse

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O15085

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 11
Alternative name(s):
PDZ-RhoGEF
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ARHGEF11
Synonyms:KIAA0380
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14580 ARHGEF11

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605708 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15085

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9826

Open Targets

More...
OpenTargetsi
ENSG00000132694

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24968

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O15085

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ARHGEF11

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000809281 – 1522Rho guanine nucleotide exchange factor 11Add BLAST1522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2PhosphoserineCombined sources1
Modified residuei14PhosphoserineBy similarity1
Modified residuei16PhosphoserineCombined sources1
Modified residuei35PhosphoserineCombined sources1
Modified residuei245PhosphoserineCombined sources1
Modified residuei251PhosphoserineCombined sources1
Modified residuei254PhosphothreonineCombined sources1
Modified residuei255PhosphoserineBy similarity1
Modified residuei271PhosphoserineBy similarity1
Modified residuei556PhosphoserineCombined sources1
Modified residuei635PhosphoserineCombined sources1
Modified residuei663PhosphoserineCombined sources1
Modified residuei668PhosphothreonineCombined sources1
Modified residuei672PhosphothreonineCombined sources1
Modified residuei1155PhosphoserineCombined sources1
Modified residuei1295PhosphoserineCombined sources1
Modified residuei1300PhosphoserineCombined sources1
Modified residuei1457PhosphoserineCombined sources1
Modified residuei1458PhosphoserineCombined sources1
Modified residuei1462PhosphothreonineCombined sources1
Modified residuei1475PhosphothreonineCombined sources1
Modified residuei1480PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14).
Ubiquitinated by the BCR(KLHL20) E3 ubiquitin ligase complex when previously phosphorylated by MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14), leading to its degradation, thereby restricting RhoA activity and facilitating growth cone spreading and neurite outgrowth.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O15085

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O15085

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O15085

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O15085

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O15085

PeptideAtlas

More...
PeptideAtlasi
O15085

PRoteomics IDEntifications database

More...
PRIDEi
O15085

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
48441 [O15085-1]
48442 [O15085-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15085

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15085

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000132694 Expressed in 96 organ(s), highest expression level in right testis

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15085 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA011026
HPA012037
HPA014658

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GNA12 and GNA13 through the RGS domain.

Interacts with RHOA, PLXNB1 and PLXNB2.

Interacts with SLC1A6 (By similarity).

Interacts (via DH domain) with GCSAM (via C-terminus).

By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115164, 28 interactors

Database of interacting proteins

More...
DIPi
DIP-31622N

Protein interaction database and analysis system

More...
IntActi
O15085, 31 interactors

Molecular INTeraction database

More...
MINTi
O15085

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000357177

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11522
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O15085

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O15085

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini47 – 126PDZPROSITE-ProRule annotationAdd BLAST80
Domaini306 – 486RGSLPROSITE-ProRule annotationAdd BLAST181
Domaini734 – 923DHPROSITE-ProRule annotationAdd BLAST190
Domaini965 – 1079PHPROSITE-ProRule annotationAdd BLAST115

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili444 – 470Sequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1094 – 1099Poly-Pro6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The poly-Pro region is essential for plasma membrane localization upon stimulation.

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3520 Eukaryota
COG5422 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158350

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000034045

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15085

KEGG Orthology (KO)

More...
KOi
K12331

Identification of Orthologs from Complete Genome Data

More...
OMAi
TTERQIY

Database of Orthologous Groups

More...
OrthoDBi
319635at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O15085

TreeFam database of animal gene trees

More...
TreeFami
TF106495

Family and domain databases

Conserved Domains Database

More...
CDDi
cd13391 PH_PRG, 1 hit
cd08753 RGS_PDZRhoGEF, 1 hit
cd00160 RhoGEF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.900.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001478 PDZ
IPR032919 PDZ-RhoGEF
IPR036034 PDZ_sf
IPR037889 PDZRhoGEF_RGS
IPR011993 PH-like_dom_sf
IPR041020 PH_16
IPR001849 PH_domain
IPR037803 PRG_PH
IPR016137 RGS
IPR015212 RGS-like_dom
IPR036305 RGS_sf

The PANTHER Classification System

More...
PANTHERi
PTHR45872:SF1 PTHR45872:SF1, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595 PDZ, 1 hit
PF17838 PH_16, 1 hit
PF09128 RGS-like, 1 hit
PF00621 RhoGEF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 1 hit
SM00233 PH, 1 hit
SM00315 RGS, 1 hit
SM00325 RhoGEF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48065 SSF48065, 1 hit
SSF48097 SSF48097, 1 hit
SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50010 DH_2, 1 hit
PS50106 PDZ, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50132 RGS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O15085-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVRLPQSID RLSSLSSLGD SAPERKSPSH HRQPSDASET TGLVQRCVII
60 70 80 90 100
QKDQHGFGFT VSGDRIVLVQ SVRPGGAAMK AGVKEGDRII KVNGTMVTNS
110 120 130 140 150
SHLEVVKLIK SGAYVALTLL GSSPSSMGIS GLQQDPSPAG APRITSVIPS
160 170 180 190 200
PPPPPPLPPP QRITGPKPLQ DPEVQKHATQ ILRNMLRQEE KELQDILPLY
210 220 230 240 250
GDTSQRPSEG RLSLDSQEGD SGLDSGTERF PSLSESLMNR NSVLSDPGLD
260 270 280 290 300
SPRTSPVIMA RVAQHHRRQG SDAAVPSTGD QGVDQSPKPL IIGPEEDYDP
310 320 330 340 350
GYFNNESDII FQDLEKLKSR PAHLGVFLRY IFSQADPSPL LFYLCAEVYQ
360 370 380 390 400
QASPKDSRSL GKDIWNIFLE KNAPLRVKIP EMLQAEIDSR LRNSEDARGV
410 420 430 440 450
LCEAQEAAMP EIQEQIHDYR TKRTLGLGSL YGENDLLDLD GDPLRERQVA
460 470 480 490 500
EKQLAALGDI LSKYEEDRSA PMDFALNTYM SHAGIRLREA RPSNTAEKAQ
510 520 530 540 550
SAPDKDKWLP FFPKTKKSSN SKKEKDALED KKRNPILKYI GKPKSSSQST
560 570 580 590 600
FHIPLSPVEV KPGNVRNIIQ HFENNQQYDA PEPGTQRLST GSFPEDLLES
610 620 630 640 650
DSSRSEIRLG RSESLKGREE MKRSRKAENV PRSRSDVDMD AAAEATRLHQ
660 670 680 690 700
SASSSTSSLS TRSLENPTPP FTPKMGRRSI ESPSLGFCTD TLLPHLLEDD
710 720 730 740 750
LGQLSDLEPE PDAQNWQHTV GKDVVAGLTQ REIDRQEVIN ELFVTEASHL
760 770 780 790 800
RTLRVLDLIF YQRMKKENLM PREELARLFP NLPELIEIHN SWCEAMKKLR
810 820 830 840 850
EEGPIIKEIS DLMLARFDGP AREELQQVAA QFCSYQSIAL ELIKTKQRKE
860 870 880 890 900
SRFQLFMQEA ESHPQCRRLQ LRDLIISEMQ RLTKYPLLLE SIIKHTEGGT
910 920 930 940 950
SEHEKLCRAR DQCREILKYV NEAVKQTENR HRLEGYQKRL DATALERASN
960 970 980 990 1000
PLAAEFKSLD LTTRKMIHEG PLTWRISKDK TLDLHVLLLE DLLVLLQKQD
1010 1020 1030 1040 1050
EKLLLKCHSK TAVGSSDSKQ TFSPVLKLNA VLIRSVATDK RAFFIICTSK
1060 1070 1080 1090 1100
LGPPQIYELV ALTSSDKNTW MELLEEAVRN ATRHPGAAPM PVHPPPPGPR
1110 1120 1130 1140 1150
EPAQQGPTPS RVELDDSDVF HGEPEPEELP GGTGSQQRVQ GKHQVLLEDP
1160 1170 1180 1190 1200
EQEGSAEEEE LGVLPCPSTS LDGENRGIRT RNPIHLAFPG PLFMEGLADS
1210 1220 1230 1240 1250
ALEDVENLRH LILWSLLPGH TMETQAAQEP EDDLTPTPSV ISVTSHPWDP
1260 1270 1280 1290 1300
GSPGQAPPGG EGDNTQLAGL EGERPEQEDM GLCSLEHLPP RTRNSGIWES
1310 1320 1330 1340 1350
PELDRNLAED ASSTEAAGGY KVVRKAEVAG SKVVPALPES GQSEPGPPEV
1360 1370 1380 1390 1400
EGGTKATGNC FYVSMPSGPP DSSTDHSEAP MSPPQPDSLP AGQTEPQPQL
1410 1420 1430 1440 1450
QGGNDDPRRP SRSPPSLALR DVGMIFHTIE QLTLKLNRLK DMELAHRELL
1460 1470 1480 1490 1500
KSLGGESSGG TTPVGSFHTE AARWTDGSLS PPAKEPLASD SRNSHELGPC
1510 1520
PEDGSDAPLE DSTADAAASP GP
Length:1,522
Mass (Da):167,704
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCA16E125B9F8A4AA
GO
Isoform 2 (identifier: O15085-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     194-194: Q → QRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGSV

Note: No experimental confirmation available.
Show »
Length:1,562
Mass (Da):172,244
Checksum:iB12857A4FE2BA0AC
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA20834 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0617951416S → G. Corresponds to variant dbSNP:rs868188Ensembl.1
Natural variantiVAR_0242851427H → R1 PublicationCorresponds to variant dbSNP:rs945508Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042003194Q → QRICEVYSRNPASLLEEQIE GARRRVTQLQLKIQQETGGS V in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB002378 mRNA Translation: BAA20834.2 Different initiation.
AL356104 Genomic DNA No translation available.
AL157713 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52893.1
CH471121 Genomic DNA Translation: EAW52894.1
BC057394 mRNA Translation: AAH57394.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1162.1 [O15085-1]
CCDS1163.1 [O15085-2]

NCBI Reference Sequences

More...
RefSeqi
NP_055599.1, NM_014784.3 [O15085-1]
NP_937879.1, NM_198236.2 [O15085-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000361409; ENSP00000354644; ENSG00000132694 [O15085-1]
ENST00000368194; ENSP00000357177; ENSG00000132694 [O15085-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9826

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9826

UCSC genome browser

More...
UCSCi
uc001fqn.3 human [O15085-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB002378 mRNA Translation: BAA20834.2 Different initiation.
AL356104 Genomic DNA No translation available.
AL157713 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52893.1
CH471121 Genomic DNA Translation: EAW52894.1
BC057394 mRNA Translation: AAH57394.1
CCDSiCCDS1162.1 [O15085-1]
CCDS1163.1 [O15085-2]
RefSeqiNP_055599.1, NM_014784.3 [O15085-1]
NP_937879.1, NM_198236.2 [O15085-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1HTJX-ray2.20F281-490[»]
1XCGX-ray2.50A/E714-1081[»]
2DLSNMR-A44-123[»]
3KZ1X-ray2.70A/B710-1085[»]
3T06X-ray2.84A/E672-1081[»]
5E6PX-ray3.21B42-125[»]
5JHGX-ray2.50A/E714-1081[»]
5JHHX-ray2.30A/E714-1081[»]
5TYTX-ray2.40A/B/C/D41-123[»]
SMRiO15085
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi115164, 28 interactors
DIPiDIP-31622N
IntActiO15085, 31 interactors
MINTiO15085
STRINGi9606.ENSP00000357177

PTM databases

iPTMnetiO15085
PhosphoSitePlusiO15085

Polymorphism and mutation databases

BioMutaiARHGEF11

Proteomic databases

EPDiO15085
jPOSTiO15085
MassIVEiO15085
MaxQBiO15085
PaxDbiO15085
PeptideAtlasiO15085
PRIDEiO15085
ProteomicsDBi48441 [O15085-1]
48442 [O15085-2]

Genome annotation databases

EnsembliENST00000361409; ENSP00000354644; ENSG00000132694 [O15085-1]
ENST00000368194; ENSP00000357177; ENSG00000132694 [O15085-2]
GeneIDi9826
KEGGihsa:9826
UCSCiuc001fqn.3 human [O15085-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9826
DisGeNETi9826

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ARHGEF11
HGNCiHGNC:14580 ARHGEF11
HPAiHPA011026
HPA012037
HPA014658
MIMi605708 gene
neXtProtiNX_O15085
OpenTargetsiENSG00000132694
PharmGKBiPA24968

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3520 Eukaryota
COG5422 LUCA
GeneTreeiENSGT00940000158350
HOGENOMiHOG000034045
InParanoidiO15085
KOiK12331
OMAiTTERQIY
OrthoDBi319635at2759
PhylomeDBiO15085
TreeFamiTF106495

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events
R-HSA-416572 Sema4D induced cell migration and growth-cone collapse
SIGNORiO15085

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ARHGEF11 human
EvolutionaryTraceiO15085

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ARHGEF11

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9826
PharosiO15085

Protein Ontology

More...
PROi
PR:O15085

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000132694 Expressed in 96 organ(s), highest expression level in right testis
GenevisibleiO15085 HS

Family and domain databases

CDDicd13391 PH_PRG, 1 hit
cd08753 RGS_PDZRhoGEF, 1 hit
cd00160 RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001478 PDZ
IPR032919 PDZ-RhoGEF
IPR036034 PDZ_sf
IPR037889 PDZRhoGEF_RGS
IPR011993 PH-like_dom_sf
IPR041020 PH_16
IPR001849 PH_domain
IPR037803 PRG_PH
IPR016137 RGS
IPR015212 RGS-like_dom
IPR036305 RGS_sf
PANTHERiPTHR45872:SF1 PTHR45872:SF1, 2 hits
PfamiView protein in Pfam
PF00595 PDZ, 1 hit
PF17838 PH_16, 1 hit
PF09128 RGS-like, 1 hit
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SM00233 PH, 1 hit
SM00315 RGS, 1 hit
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
SSF48097 SSF48097, 1 hit
SSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50010 DH_2, 1 hit
PS50106 PDZ, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50132 RGS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARHGB_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15085
Secondary accession number(s): D3DVD0, Q5VY40, Q6PFW2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: January 1, 1998
Last modified: October 16, 2019
This is version 185 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again