Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho guanine nucleotide exchange factor 11

Gene

ARHGEF11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13. Involved in neurotrophin-induced neurite outgrowth.1 Publication

GO - Molecular functioni

  • G protein-coupled receptor binding Source: MGI
  • GTPase activator activity Source: UniProtKB-KW
  • guanyl-nucleotide exchange factor activity Source: Reactome
  • Rho guanyl-nucleotide exchange factor activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionGTPase activation, Guanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events
R-HSA-416572 Sema4D induced cell migration and growth-cone collapse

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 11
Alternative name(s):
PDZ-RhoGEF
Gene namesi
Name:ARHGEF11
Synonyms:KIAA0380
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000132694.18
HGNCiHGNC:14580 ARHGEF11
MIMi605708 gene
neXtProtiNX_O15085

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9826
OpenTargetsiENSG00000132694
PharmGKBiPA24968

Polymorphism and mutation databases

BioMutaiARHGEF11

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809281 – 1522Rho guanine nucleotide exchange factor 11Add BLAST1522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2PhosphoserineCombined sources1
Modified residuei14PhosphoserineBy similarity1
Modified residuei16PhosphoserineCombined sources1
Modified residuei35PhosphoserineCombined sources1
Modified residuei245PhosphoserineCombined sources1
Modified residuei251PhosphoserineCombined sources1
Modified residuei254PhosphothreonineCombined sources1
Modified residuei255PhosphoserineBy similarity1
Modified residuei271PhosphoserineBy similarity1
Modified residuei556PhosphoserineCombined sources1
Modified residuei635PhosphoserineCombined sources1
Modified residuei663PhosphoserineCombined sources1
Modified residuei668PhosphothreonineCombined sources1
Modified residuei672PhosphothreonineCombined sources1
Modified residuei1155PhosphoserineCombined sources1
Modified residuei1295PhosphoserineCombined sources1
Modified residuei1300PhosphoserineCombined sources1
Modified residuei1457PhosphoserineCombined sources1
Modified residuei1458PhosphoserineCombined sources1
Modified residuei1462PhosphothreonineCombined sources1
Modified residuei1475PhosphothreonineCombined sources1
Modified residuei1480PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14).
Ubiquitinated by the BCR(KLHL20) E3 ubiquitin ligase complex when previously phosphorylated by MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14), leading to its degradation, thereby restricting RhoA activity and facilitating growth cone spreading and neurite outgrowth.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiO15085
MaxQBiO15085
PaxDbiO15085
PeptideAtlasiO15085
PRIDEiO15085
ProteomicsDBi48441
48442 [O15085-2]

PTM databases

iPTMnetiO15085
PhosphoSitePlusiO15085

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000132694 Expressed in 96 organ(s), highest expression level in right testis
CleanExiHS_ARHGEF11
GenevisibleiO15085 HS

Organism-specific databases

HPAiHPA011026
HPA012037
HPA014658

Interactioni

Subunit structurei

Interacts with GNA12 and GNA13 through the RGS domain. Interacts with RHOA, PLXNB1 and PLXNB2. Interacts with SLC1A6 (By similarity). Interacts (via DH domain) with GCSAM (via C-terminus).By similarity5 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115164, 23 interactors
DIPiDIP-31622N
IntActiO15085, 24 interactors
MINTiO15085
STRINGi9606.ENSP00000357177

Structurei

Secondary structure

11522
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO15085
SMRiO15085
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15085

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini47 – 126PDZPROSITE-ProRule annotationAdd BLAST80
Domaini306 – 486RGSLPROSITE-ProRule annotationAdd BLAST181
Domaini734 – 923DHPROSITE-ProRule annotationAdd BLAST190
Domaini965 – 1079PHPROSITE-ProRule annotationAdd BLAST115

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili444 – 470Sequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1094 – 1099Poly-Pro6

Domaini

The poly-Pro region is essential for plasma membrane localization upon stimulation.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG3520 Eukaryota
COG5422 LUCA
GeneTreeiENSGT00760000119193
HOGENOMiHOG000034045
HOVERGENiHBG101340
InParanoidiO15085
KOiK12331
OMAiAAGNCFY
OrthoDBiEOG091G0CZH
PhylomeDBiO15085
TreeFamiTF106495

Family and domain databases

CDDicd13391 PH_PRG, 1 hit
cd08753 RGS_PDZRhoGEF, 1 hit
cd00160 RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001478 PDZ
IPR032919 PDZ-RhoGEF
IPR036034 PDZ_sf
IPR037889 PDZRhoGEF_RGS
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR037803 PRG_PH
IPR016137 RGS
IPR015212 RGS-like_dom
IPR036305 RGS_sf
PANTHERiPTHR12673:SF111 PTHR12673:SF111, 1 hit
PfamiView protein in Pfam
PF00595 PDZ, 1 hit
PF09128 RGS-like, 1 hit
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SM00233 PH, 1 hit
SM00315 RGS, 1 hit
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
SSF48097 SSF48097, 1 hit
SSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50010 DH_2, 1 hit
PS50106 PDZ, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50132 RGS, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O15085-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVRLPQSID RLSSLSSLGD SAPERKSPSH HRQPSDASET TGLVQRCVII
60 70 80 90 100
QKDQHGFGFT VSGDRIVLVQ SVRPGGAAMK AGVKEGDRII KVNGTMVTNS
110 120 130 140 150
SHLEVVKLIK SGAYVALTLL GSSPSSMGIS GLQQDPSPAG APRITSVIPS
160 170 180 190 200
PPPPPPLPPP QRITGPKPLQ DPEVQKHATQ ILRNMLRQEE KELQDILPLY
210 220 230 240 250
GDTSQRPSEG RLSLDSQEGD SGLDSGTERF PSLSESLMNR NSVLSDPGLD
260 270 280 290 300
SPRTSPVIMA RVAQHHRRQG SDAAVPSTGD QGVDQSPKPL IIGPEEDYDP
310 320 330 340 350
GYFNNESDII FQDLEKLKSR PAHLGVFLRY IFSQADPSPL LFYLCAEVYQ
360 370 380 390 400
QASPKDSRSL GKDIWNIFLE KNAPLRVKIP EMLQAEIDSR LRNSEDARGV
410 420 430 440 450
LCEAQEAAMP EIQEQIHDYR TKRTLGLGSL YGENDLLDLD GDPLRERQVA
460 470 480 490 500
EKQLAALGDI LSKYEEDRSA PMDFALNTYM SHAGIRLREA RPSNTAEKAQ
510 520 530 540 550
SAPDKDKWLP FFPKTKKSSN SKKEKDALED KKRNPILKYI GKPKSSSQST
560 570 580 590 600
FHIPLSPVEV KPGNVRNIIQ HFENNQQYDA PEPGTQRLST GSFPEDLLES
610 620 630 640 650
DSSRSEIRLG RSESLKGREE MKRSRKAENV PRSRSDVDMD AAAEATRLHQ
660 670 680 690 700
SASSSTSSLS TRSLENPTPP FTPKMGRRSI ESPSLGFCTD TLLPHLLEDD
710 720 730 740 750
LGQLSDLEPE PDAQNWQHTV GKDVVAGLTQ REIDRQEVIN ELFVTEASHL
760 770 780 790 800
RTLRVLDLIF YQRMKKENLM PREELARLFP NLPELIEIHN SWCEAMKKLR
810 820 830 840 850
EEGPIIKEIS DLMLARFDGP AREELQQVAA QFCSYQSIAL ELIKTKQRKE
860 870 880 890 900
SRFQLFMQEA ESHPQCRRLQ LRDLIISEMQ RLTKYPLLLE SIIKHTEGGT
910 920 930 940 950
SEHEKLCRAR DQCREILKYV NEAVKQTENR HRLEGYQKRL DATALERASN
960 970 980 990 1000
PLAAEFKSLD LTTRKMIHEG PLTWRISKDK TLDLHVLLLE DLLVLLQKQD
1010 1020 1030 1040 1050
EKLLLKCHSK TAVGSSDSKQ TFSPVLKLNA VLIRSVATDK RAFFIICTSK
1060 1070 1080 1090 1100
LGPPQIYELV ALTSSDKNTW MELLEEAVRN ATRHPGAAPM PVHPPPPGPR
1110 1120 1130 1140 1150
EPAQQGPTPS RVELDDSDVF HGEPEPEELP GGTGSQQRVQ GKHQVLLEDP
1160 1170 1180 1190 1200
EQEGSAEEEE LGVLPCPSTS LDGENRGIRT RNPIHLAFPG PLFMEGLADS
1210 1220 1230 1240 1250
ALEDVENLRH LILWSLLPGH TMETQAAQEP EDDLTPTPSV ISVTSHPWDP
1260 1270 1280 1290 1300
GSPGQAPPGG EGDNTQLAGL EGERPEQEDM GLCSLEHLPP RTRNSGIWES
1310 1320 1330 1340 1350
PELDRNLAED ASSTEAAGGY KVVRKAEVAG SKVVPALPES GQSEPGPPEV
1360 1370 1380 1390 1400
EGGTKATGNC FYVSMPSGPP DSSTDHSEAP MSPPQPDSLP AGQTEPQPQL
1410 1420 1430 1440 1450
QGGNDDPRRP SRSPPSLALR DVGMIFHTIE QLTLKLNRLK DMELAHRELL
1460 1470 1480 1490 1500
KSLGGESSGG TTPVGSFHTE AARWTDGSLS PPAKEPLASD SRNSHELGPC
1510 1520
PEDGSDAPLE DSTADAAASP GP
Length:1,522
Mass (Da):167,704
Last modified:January 1, 1998 - v1
Checksum:iCA16E125B9F8A4AA
GO
Isoform 2 (identifier: O15085-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     194-194: Q → QRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGSV

Note: No experimental confirmation available.
Show »
Length:1,562
Mass (Da):172,244
Checksum:iB12857A4FE2BA0AC
GO

Sequence cautioni

The sequence BAA20834 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0617951416S → G. Corresponds to variant dbSNP:rs868188Ensembl.1
Natural variantiVAR_0242851427H → R1 PublicationCorresponds to variant dbSNP:rs945508Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042003194Q → QRICEVYSRNPASLLEEQIE GARRRVTQLQLKIQQETGGS V in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB002378 mRNA Translation: BAA20834.2 Different initiation.
AL356104 Genomic DNA No translation available.
AL157713 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52893.1
CH471121 Genomic DNA Translation: EAW52894.1
BC057394 mRNA Translation: AAH57394.1
CCDSiCCDS1162.1 [O15085-1]
CCDS1163.1 [O15085-2]
RefSeqiNP_055599.1, NM_014784.3 [O15085-1]
NP_937879.1, NM_198236.2 [O15085-2]
UniGeneiHs.516954

Genome annotation databases

EnsembliENST00000361409; ENSP00000354644; ENSG00000132694 [O15085-1]
ENST00000368194; ENSP00000357177; ENSG00000132694 [O15085-2]
GeneIDi9826
KEGGihsa:9826
UCSCiuc001fqn.3 human [O15085-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB002378 mRNA Translation: BAA20834.2 Different initiation.
AL356104 Genomic DNA No translation available.
AL157713 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52893.1
CH471121 Genomic DNA Translation: EAW52894.1
BC057394 mRNA Translation: AAH57394.1
CCDSiCCDS1162.1 [O15085-1]
CCDS1163.1 [O15085-2]
RefSeqiNP_055599.1, NM_014784.3 [O15085-1]
NP_937879.1, NM_198236.2 [O15085-2]
UniGeneiHs.516954

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1HTJX-ray2.20F281-490[»]
1XCGX-ray2.50A/E714-1081[»]
2DLSNMR-A44-123[»]
3KZ1X-ray2.70A/B710-1085[»]
3T06X-ray2.84A/E672-1081[»]
5E6PX-ray3.21B42-125[»]
5JHGX-ray2.50A/E714-1081[»]
5JHHX-ray2.30A/E714-1081[»]
5TYTX-ray2.40A/B/C/D41-123[»]
ProteinModelPortaliO15085
SMRiO15085
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115164, 23 interactors
DIPiDIP-31622N
IntActiO15085, 24 interactors
MINTiO15085
STRINGi9606.ENSP00000357177

PTM databases

iPTMnetiO15085
PhosphoSitePlusiO15085

Polymorphism and mutation databases

BioMutaiARHGEF11

Proteomic databases

EPDiO15085
MaxQBiO15085
PaxDbiO15085
PeptideAtlasiO15085
PRIDEiO15085
ProteomicsDBi48441
48442 [O15085-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361409; ENSP00000354644; ENSG00000132694 [O15085-1]
ENST00000368194; ENSP00000357177; ENSG00000132694 [O15085-2]
GeneIDi9826
KEGGihsa:9826
UCSCiuc001fqn.3 human [O15085-1]

Organism-specific databases

CTDi9826
DisGeNETi9826
EuPathDBiHostDB:ENSG00000132694.18
GeneCardsiARHGEF11
HGNCiHGNC:14580 ARHGEF11
HPAiHPA011026
HPA012037
HPA014658
MIMi605708 gene
neXtProtiNX_O15085
OpenTargetsiENSG00000132694
PharmGKBiPA24968
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3520 Eukaryota
COG5422 LUCA
GeneTreeiENSGT00760000119193
HOGENOMiHOG000034045
HOVERGENiHBG101340
InParanoidiO15085
KOiK12331
OMAiAAGNCFY
OrthoDBiEOG091G0CZH
PhylomeDBiO15085
TreeFamiTF106495

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events
R-HSA-416572 Sema4D induced cell migration and growth-cone collapse

Miscellaneous databases

ChiTaRSiARHGEF11 human
EvolutionaryTraceiO15085
GeneWikiiARHGEF11
GenomeRNAii9826
PROiPR:O15085
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000132694 Expressed in 96 organ(s), highest expression level in right testis
CleanExiHS_ARHGEF11
GenevisibleiO15085 HS

Family and domain databases

CDDicd13391 PH_PRG, 1 hit
cd08753 RGS_PDZRhoGEF, 1 hit
cd00160 RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001478 PDZ
IPR032919 PDZ-RhoGEF
IPR036034 PDZ_sf
IPR037889 PDZRhoGEF_RGS
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR037803 PRG_PH
IPR016137 RGS
IPR015212 RGS-like_dom
IPR036305 RGS_sf
PANTHERiPTHR12673:SF111 PTHR12673:SF111, 1 hit
PfamiView protein in Pfam
PF00595 PDZ, 1 hit
PF09128 RGS-like, 1 hit
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SM00233 PH, 1 hit
SM00315 RGS, 1 hit
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
SSF48097 SSF48097, 1 hit
SSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50010 DH_2, 1 hit
PS50106 PDZ, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50132 RGS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiARHGB_HUMAN
AccessioniPrimary (citable) accession number: O15085
Secondary accession number(s): D3DVD0, Q5VY40, Q6PFW2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: January 1, 1998
Last modified: November 7, 2018
This is version 176 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again