Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 175 (05 Jun 2019)
Sequence version 5 (03 May 2011)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A

Gene

ANKRD28

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Putative regulatory subunit of protein phosphatase 6 (PP6) that may be involved in the recognition of phosphoprotein substrates. Involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. Selectively inhibits the phosphatase activity of PPP1C. Targets PPP1C to modulate HNRPK phosphorylation.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-204005 COPII-mediated vesicle transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
Short name:
PP6-ARS-A
Short name:
Serine/threonine-protein phosphatase 6 regulatory subunit ARS-A
Alternative name(s):
Ankyrin repeat domain-containing protein 28
Phosphatase interactor targeting protein hnRNP K
Short name:
PITK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANKRD28
Synonyms:KIAA0379
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29024 ANKRD28

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611122 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15084

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1007 – 1011SKTVS → AKTVA: Marked decrease in phosphorylation. Increased PPP1C-binding. No effect on HNRPK-binding. 1 Publication5

Organism-specific databases

DisGeNET

More...
DisGeNETi
23243

Open Targets

More...
OpenTargetsi
ENSG00000206560

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134880251

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4105921

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANKRD28

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000669191 – 1053Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit AAdd BLAST1053

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1007Phosphoserine1 Publication1
Modified residuei1011PhosphoserineCombined sources1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O15084

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O15084

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O15084

PeptideAtlas

More...
PeptideAtlasi
O15084

PRoteomics IDEntifications database

More...
PRIDEi
O15084

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48437
48438 [O15084-1]
48439 [O15084-2]
48440 [O15084-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15084

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15084

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000206560 Expressed in 225 organ(s), highest expression level in caput epididymis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O15084 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15084 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Protein phosphatase 6 (PP6) holoenzyme is proposed to be a heterotrimeric complex formed by the catalytic subunit, a SAPS domain-containing subunit (PP6R) and an ankyrin repeat-domain containing regulatory subunit (ARS). Interacts with PPP1C and HNRPK. Interacts with PPP6C, PPP6R1 and PPP6R3.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116847, 98 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O15084

Database of interacting proteins

More...
DIPi
DIP-27583N

Protein interaction database and analysis system

More...
IntActi
O15084, 99 interactors

Molecular INTeraction database

More...
MINTi
O15084

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000382379

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O15084

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati40 – 69ANK 1Add BLAST30
Repeati73 – 102ANK 2Add BLAST30
Repeati106 – 135ANK 3Add BLAST30
Repeati139 – 168ANK 4Add BLAST30
Repeati172 – 201ANK 5Add BLAST30
Repeati205 – 234ANK 6Add BLAST30
Repeati238 – 267ANK 7Add BLAST30
Repeati271 – 301ANK 8Add BLAST31
Repeati305 – 334ANK 9Add BLAST30
Repeati338 – 367ANK 10Add BLAST30
Repeati371 – 400ANK 11Add BLAST30
Repeati404 – 433ANK 12Add BLAST30
Repeati437 – 466ANK 13Add BLAST30
Repeati470 – 500ANK 14Add BLAST31
Repeati504 – 534ANK 15Add BLAST31
Repeati549 – 578ANK 16Add BLAST30
Repeati582 – 611ANK 17Add BLAST30
Repeati616 – 645ANK 18Add BLAST30
Repeati652 – 681ANK 19Add BLAST30
Repeati685 – 714ANK 20Add BLAST30
Repeati718 – 747ANK 21Add BLAST30
Repeati755 – 784ANK 22Add BLAST30
Repeati787 – 817ANK 23Add BLAST31
Repeati822 – 851ANK 24Add BLAST30
Repeati855 – 885ANK 25Add BLAST31
Repeati889 – 918ANK 26Add BLAST30
Repeati925 – 954ANK 27Add BLAST30

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0504 Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182908

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000033959

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15084

KEGG Orthology (KO)

More...
KOi
K15502

Identification of Orthologs from Complete Genome Data

More...
OMAi
HSSYCSF

Database of Orthologous Groups

More...
OrthoDBi
1115202at2759

TreeFam database of animal gene trees

More...
TreeFami
TF312824

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00204 ANK, 7 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 10 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00023 Ank, 1 hit
PF12796 Ank_2, 8 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01415 ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 28 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 24 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15084-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAFLKLRDQP SLVQAIFNGD PDEVRALIFK KEDVNFQDNE KRTPLHAAAY
60 70 80 90 100
LGDAEIIELL ILSGARVNAK DSKWLTPLHR AVASCSEEAV QVLLKHSADV
110 120 130 140 150
NARDKNWQTP LHIAAANKAV KCAEALVPLL SNVNVSDRAG RTALHHAAFS
160 170 180 190 200
GHGEMVKLLL SRGANINAFD KKDRRAIHWA AYMGHIEVVK LLVSHGAEVT
210 220 230 240 250
CKDKKSYTPL HAAASSGMIS VVKYLLDLGV DMNEPNAYGN TPLHVACYNG
260 270 280 290 300
QDVVVNELID CGAIVNQKNE KGFTPLHFAA ASTHGALCLE LLVGNGADVN
310 320 330 340 350
MKSKDGKTPL HMTALHGRFS RSQTIIQSGA VIDCEDKNGN TPLHIAARYG
360 370 380 390 400
HELLINTLIT SGADTAKRGI HGMFPLHLAA LSGFSDCCRK LLSSGFDIDT
410 420 430 440 450
PDDFGRTCLH AAAAGGNLEC LNLLLNTGAD FNKKDKFGRS PLHYAAANCN
460 470 480 490 500
YQCLFALVGS GASVNDLDER GCTPLHYAAT SDTDGKCLEY LLRNDANPGI
510 520 530 540 550
RDKQGYNAVH YSAAYGHRLC LQLIASETPL DVLMETSGTD MLSDSDNRAT
560 570 580 590 600
ISPLHLAAYH GHHQALEVLV QSLLDLDVRN SSGRTPLDLA AFKGHVECVD
610 620 630 640 650
VLINQGASIL VKDYILKRTP IHAAATNGHS ECLRLLIGNA EPQNAVDIQD
660 670 680 690 700
GNGQTPLMLS VLNGHTDCVY SLLNKGANVD AKDKWGRTAL HRGAVTGHEE
710 720 730 740 750
CVDALLQHGA KCLLRDSRGR TPIHLSAACG HIGVLGALLQ SAASMDANPA
760 770 780 790 800
TADNHGYTAL HWACYNGHET CVELLLEQEV FQKTEGNAFS PLHCAVINDN
810 820 830 840 850
EGAAEMLIDT LGASIVNATD SKGRTPLHAA AFTDHVECLQ LLLSHNAQVN
860 870 880 890 900
SVDSTGKTPL MMAAENGQTN TVEMLVSSAS AELTLQDNSK NTALHLACSK
910 920 930 940 950
GHETSALLIL EKITDRNLIN ATNAALQTPL HVAARNGLTM VVQELLGKGA
960 970 980 990 1000
SVLAVDENGY TPALACAPNK DVADCLALIL ATMMPVSSSS PLSSLTFNAI
1010 1020 1030 1040 1050
NRYTNTSKTV SFEALPIMRN EPSSYCSFNN IGGEQEYLYT DVDELNDSDS

ETY
Length:1,053
Mass (Da):112,966
Last modified:May 3, 2011 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBDB4855193364585
GO
Isoform 2 (identifier: O15084-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-154: Missing.

Note: Produced by alternative promoter usage.
Show »
Length:899
Mass (Da):96,161
Checksum:iE06723898ABF4B08
GO
Isoform 3 (identifier: O15084-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MAFLKLRDQ → MSRVCIVVLEEVEDESPAFISKLPQENKSLHSPPSGNVLVRY

Show »
Length:1,086
Mass (Da):116,543
Checksum:i47A3F97E5C72F0E8
GO
Isoform 4 (identifier: O15084-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MAFLKLRDQ → MSRVCIVVLEEVEDESPAFISKLPQENKSLHSPPSGNVL

Note: No experimental confirmation available.
Show »
Length:1,083
Mass (Da):116,124
Checksum:i349BC9338F251E08
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DIW9B4DIW9_HUMAN
Serine/threonine-protein phosphatas...
ANKRD28
722Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDU2F8WDU2_HUMAN
Serine/threonine-protein phosphatas...
ANKRD28
14Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAQ72374 differs from that shown. Reason: Frameshift at position 408.Curated
The sequence BAA20833 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC86737 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti293V → A in AAQ72374 (Ref. 1) Curated1
Sequence conflicti500I → V in AAQ72374 (Ref. 1) Curated1
Sequence conflicti500I → V in BAC86737 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0124331 – 154Missing in isoform 2. 2 PublicationsAdd BLAST154
Alternative sequenceiVSP_0410131 – 9MAFLKLRDQ → MSRVCIVVLEEVEDESPAFI SKLPQENKSLHSPPSGNVLV RY in isoform 3. 2 Publications9
Alternative sequenceiVSP_0410141 – 9MAFLKLRDQ → MSRVCIVVLEEVEDESPAFI SKLPQENKSLHSPPSGNVL in isoform 4. 1 Publication9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY367056 mRNA Translation: AAQ72374.1 Frameshift.
AB002377 mRNA Translation: BAA20833.2 Different initiation.
AK126888 mRNA Translation: BAC86737.1 Sequence problems.
AK293770 mRNA Translation: BAG57186.1
BC106948 mRNA Translation: AAI06949.2
BC113868 mRNA Translation: AAI13869.1
BC114476 mRNA Translation: AAI14477.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46769.1 [O15084-3]
CCDS74908.1 [O15084-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001182027.1, NM_001195098.1 [O15084-2]
NP_001182028.1, NM_001195099.1 [O15084-2]
NP_056014.2, NM_015199.3 [O15084-3]
XP_005265053.1, XM_005264996.3
XP_011531842.1, XM_011533540.2
XP_016861515.1, XM_017006026.1
XP_016861516.1, XM_017006027.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000399451; ENSP00000382379; ENSG00000206560 [O15084-3]
ENST00000412318; ENSP00000397341; ENSG00000206560 [O15084-3]
ENST00000624145; ENSP00000485421; ENSG00000206560 [O15084-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23243

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23243

UCSC genome browser

More...
UCSCi
uc003cai.2 human [O15084-3]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY367056 mRNA Translation: AAQ72374.1 Frameshift.
AB002377 mRNA Translation: BAA20833.2 Different initiation.
AK126888 mRNA Translation: BAC86737.1 Sequence problems.
AK293770 mRNA Translation: BAG57186.1
BC106948 mRNA Translation: AAI06949.2
BC113868 mRNA Translation: AAI13869.1
BC114476 mRNA Translation: AAI14477.1
CCDSiCCDS46769.1 [O15084-3]
CCDS74908.1 [O15084-2]
RefSeqiNP_001182027.1, NM_001195098.1 [O15084-2]
NP_001182028.1, NM_001195099.1 [O15084-2]
NP_056014.2, NM_015199.3 [O15084-3]
XP_005265053.1, XM_005264996.3
XP_011531842.1, XM_011533540.2
XP_016861515.1, XM_017006026.1
XP_016861516.1, XM_017006027.1

3D structure databases

SMRiO15084
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116847, 98 interactors
CORUMiO15084
DIPiDIP-27583N
IntActiO15084, 99 interactors
MINTiO15084
STRINGi9606.ENSP00000382379

Chemistry databases

ChEMBLiCHEMBL4105921

PTM databases

iPTMnetiO15084
PhosphoSitePlusiO15084

Polymorphism and mutation databases

BioMutaiANKRD28

Proteomic databases

EPDiO15084
jPOSTiO15084
PaxDbiO15084
PeptideAtlasiO15084
PRIDEiO15084
ProteomicsDBi48437
48438 [O15084-1]
48439 [O15084-2]
48440 [O15084-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
23243
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000399451; ENSP00000382379; ENSG00000206560 [O15084-3]
ENST00000412318; ENSP00000397341; ENSG00000206560 [O15084-3]
ENST00000624145; ENSP00000485421; ENSG00000206560 [O15084-2]
GeneIDi23243
KEGGihsa:23243
UCSCiuc003cai.2 human [O15084-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23243
DisGeNETi23243

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANKRD28

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0003106
HGNCiHGNC:29024 ANKRD28
MIMi611122 gene
neXtProtiNX_O15084
OpenTargetsiENSG00000206560
PharmGKBiPA134880251

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00950000182908
HOGENOMiHOG000033959
InParanoidiO15084
KOiK15502
OMAiHSSYCSF
OrthoDBi1115202at2759
TreeFamiTF312824

Enzyme and pathway databases

ReactomeiR-HSA-204005 COPII-mediated vesicle transport

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANKRD28 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23243

Protein Ontology

More...
PROi
PR:O15084

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000206560 Expressed in 225 organ(s), highest expression level in caput epididymis
ExpressionAtlasiO15084 baseline and differential
GenevisibleiO15084 HS

Family and domain databases

CDDicd00204 ANK, 7 hits
Gene3Di1.25.40.20, 10 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
PfamiView protein in Pfam
PF00023 Ank, 1 hit
PF12796 Ank_2, 8 hits
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 28 hits
SUPFAMiSSF48403 SSF48403, 4 hits
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 24 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANR28_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15084
Secondary accession number(s): B4DES5
, Q1WWL4, Q29RW6, Q3B857, Q6ULS0, Q6ZT57
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: May 3, 2011
Last modified: June 5, 2019
This is version 175 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again