Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Guanine nucleotide exchange factor DBS

Gene

MCF2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor that catalyzes guanine nucleotide exchange on RHOA and CDC42, and thereby contributes to the regulation of RHOA and CDC42 signaling pathways (By similarity). Seems to lack activity with RAC1. Becomes activated and highly tumorigenic by truncation of the N-terminus (By similarity). Isoform 5 activates CDC42 (PubMed:15157669).By similarity1 Publication
Isoform 3: Does not catalyze guanine nucleotide exchange on CDC42 (PubMed:15157669).1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor
LigandLipid-binding

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events

Chemistry databases

SwissLipidsiSLP:000001547

Names & Taxonomyi

Protein namesi
Recommended name:
Guanine nucleotide exchange factor DBS
Alternative name(s):
DBL's big sister
MCF2-transforming sequence-like protein
Gene namesi
Name:MCF2L
Synonyms:KIAA0362, OST1 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000126217.20
HGNCiHGNC:14576 MCF2L
MIMi609499 gene
neXtProtiNX_O15068

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNETi23263
OpenTargetsiENSG00000126217
PharmGKBiPA30685

Polymorphism and mutation databases

BioMutaiMCF2L

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809351 – 1137Guanine nucleotide exchange factor DBSAdd BLAST1137

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei457PhosphoserineBy similarity1
Modified residuei480PhosphoserineBy similarity1
Modified residuei620PhosphoserineBy similarity1
Modified residuei1033PhosphoserineBy similarity1
Modified residuei1034PhosphoserineBy similarity1
Modified residuei1041PhosphoserineBy similarity1
Modified residuei1042PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO15068
MaxQBiO15068
PaxDbiO15068
PeptideAtlasiO15068
PRIDEiO15068
ProteomicsDBi48418
48419 [O15068-2]
48420 [O15068-3]
48421 [O15068-4]
48422 [O15068-5]
48423 [O15068-6]
48424 [O15068-8]
48425 [O15068-9]

PTM databases

iPTMnetiO15068
PhosphoSitePlusiO15068

Expressioni

Gene expression databases

BgeeiENSG00000126217 Expressed in 195 organ(s), highest expression level in right hemisphere of cerebellum
ExpressionAtlasiO15068 baseline and differential
GenevisibleiO15068 HS

Interactioni

Subunit structurei

Interacts with GTP-bound RAC1 (By similarity). Interacts with CDC42 (PubMed:15157669). Interacts with RHOA. Interacts with CCPG1, which results in specific inhibition of its exchange activity toward RHOA, but does not affect its activity on CDC42 (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116865, 10 interactors
IntActiO15068, 6 interactors
MINTiO15068
STRINGi9606.ENSP00000440374

Structurei

3D structure databases

ProteinModelPortaliO15068
SMRiO15068
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini52 – 224CRAL-TRIOPROSITE-ProRule annotationAdd BLAST173
Repeati351 – 456SpectrinAdd BLAST106
Domaini631 – 811DHPROSITE-ProRule annotationAdd BLAST181
Domaini829 – 945PHPROSITE-ProRule annotationAdd BLAST117
Domaini1055 – 1116SH3PROSITE-ProRule annotationAdd BLAST62

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili503 – 529Sequence analysisAdd BLAST27

Domaini

The CRAL-TRIO domain mediates interaction with various inositol phospholipids, such as phosphatidylinositol 3-phosphate (PI3P), phosphatidylinositol 4-phosphate (PI4P) and phosphatidylinositol 5-phosphate (PI5P).1 Publication
The DH domain is involved in interaction with CCPG1.By similarity

Sequence similaritiesi

Belongs to the MCF2 family.Curated

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiENOG410IPNH Eukaryota
ENOG410XNYV LUCA
GeneTreeiENSGT00930000150837
HOGENOMiHOG000231361
HOVERGENiHBG062385
InParanoidiO15068
KOiK20685
OMAiWYVRNLT
OrthoDBiEOG091G04A2
PhylomeDBiO15068
TreeFamiTF318080

Family and domain databases

CDDicd01227 PH_Dbs, 1 hit
cd00160 RhoGEF, 1 hit
cd00170 SEC14, 1 hit
cd11857 SH3_DBS, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR001251 CRAL-TRIO_dom
IPR036865 CRAL-TRIO_dom_sf
IPR035899 DBL_dom_sf
IPR035534 DBS_PH
IPR035532 DBS_SH3
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR018159 Spectrin/alpha-actinin
IPR002017 Spectrin_repeat
PfamiView protein in Pfam
PF13716 CRAL_TRIO_2, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF07653 SH3_2, 1 hit
PF00435 Spectrin, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00516 SEC14, 1 hit
SM00326 SH3, 1 hit
SM00150 SPEC, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 1 hit
SSF52087 SSF52087, 1 hit
PROSITEiView protein in PROSITE
PS50191 CRAL_TRIO, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50002 SH3, 1 hit

Sequences (9+)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket
Note: A number of isoforms are produced. According to EST sequences. Experimental confirmation may be lacking for some isoforms.

This entry has 9 described isoforms and 16 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15068-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFDCWRFILC KRPGSNSYSS PQRPNEAKKE ETDHQIDVSD VIRLVQDTPE
60 70 80 90 100
ATAMATDEIM HQDIVPLCAA DIQDQLKKRF AYLSGGRGQD GSPVITFPDY
110 120 130 140 150
PAFSEIPDKE FQNVMTYLTS IPSLQDAGIG FILVIDRRRD KWTSVKASVL
160 170 180 190 200
RIAASFPANL QLVLVLRPTG FFQRTLSDIA FKFNRDDFKM KVPVIMLSSV
210 220 230 240 250
PDLHGYIDKS QLTEDLGGTL DYCHSRWLCQ RTAIESFALM VKQTAQMLQS
260 270 280 290 300
FGTELAETEL PNDVQSTSSV LCAHTEKKDK AKEDLRLALK EGHSVLESLR
310 320 330 340 350
ELQAEGSEPS VNQDQLDNQA TVQRLLAQLN ETEAAFDEFW AKHQQKLEQC
360 370 380 390 400
LQLRHFEQGF REVKAILDAA SQKIATFTDI GNSLAHVEHL LRDLASFEEK
410 420 430 440 450
SGVAVERARA LSLDGEQLIG NKHYAVDSIR PKCQELRHLC DQFSAEIARR
460 470 480 490 500
RGLLSKSLEL HRRLETSMKW CDEGIYLLAS QPVDKCQSQD GAEAALQEIE
510 520 530 540 550
KFLETGAENK IQELNAIYKE YESILNQDLM EHVRKVFQKQ ASMEEVFHRR
560 570 580 590 600
QASLKKLAAR QTRPVQPVAP RPEALAKSPC PSPGIRRGSE NSSSEGGALR
610 620 630 640 650
RGPYRRAKSE MSESRQGRGS AGEEEESLAI LRRHVMSELL DTERAYVEEL
660 670 680 690 700
LCVLEGYAAE MDNPLMAHLL STGLHNKKDV LFGNMEEIYH FHNRIFLREL
710 720 730 740 750
ENYTDCPELV GRCFLERMED FQIYEKYCQN KPRSESLWRQ CSDCPFFQEC
760 770 780 790 800
QRKLDHKLSL DSYLLKPVQR ITKYQLLLKE MLKYSRNCEG AEDLQEALSS
810 820 830 840 850
ILGILKAVND SMHLIAITGY DGNLGDLGKL LMQGSFSVWT DHKRGHTKVK
860 870 880 890 900
ELARFKPMQR HLFLHEKAVL FCKKREENGE GYEKAPSYSY KQSLNMAAVG
910 920 930 940 950
ITENVKGDAK KFEIWYNARE EVYIVQAPTP EIKAAWVNEI RKVLTSQLQA
960 970 980 990 1000
CREASQHRAL EQSQSLPLPA PTSTSPSRGN SRNIKKLEER KTDPLSLEGY
1010 1020 1030 1040 1050
VSSAPLTKPP EKGKGWSKTS HSLEAPEDDG GWSSAEEQIN SSDAEEDGGL
1060 1070 1080 1090 1100
GPKKLVPGKY TVVADHEKGG PDALRVRSGD VVELVQEGDE GLWYVRDPTT
1110 1120 1130
GKEGWVPASS LSVRLGPSGS AQCLSSSGKA HVPRAHP
Note: Gene prediction based on similarity to mouse ortholog.
Length:1,137
Mass (Da):128,109
Last modified:June 12, 2007 - v2
Checksum:iB2830890A69C8377
GO
Isoform 2 (identifier: O15068-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MPLRGGAGPS...SFYTCHGAAG
     1094-1137: Missing.

Show »
Length:1,096
Mass (Da):122,895
Checksum:i31D641D6773111D8
GO
Isoform 3 (identifier: O15068-3) [UniParc]FASTAAdd to basket
Also known as: Ost-II1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MAEKGASRGTLRRLWSLPRRRRGTAGRSRP
     1094-1137: Missing.

Show »
Length:1,067
Mass (Da):120,618
Checksum:i2F3F56C9605F5065
GO
Isoform 4 (identifier: O15068-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MTVRRLSLLCRDLWALWLLLKAGA
     1015-1016: GW → EP
     1017-1137: Missing.

Show »
Length:984
Mass (Da):111,862
Checksum:i50B50DCB7CCF0AE1
GO
Isoform 5 (identifier: O15068-5) [UniParc]FASTAAdd to basket
Also known as: Ost-I1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-189: Missing.
     1094-1137: Missing.

Show »
Length:904
Mass (Da):102,175
Checksum:i563456F50829E587
GO
Isoform 6 (identifier: O15068-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MRFWLRTEEMALEEMVQRLNAVSKHT

Show »
Length:1,107
Mass (Da):124,902
Checksum:iEA759E18895EA8A7
GO
Isoform 7 (identifier: O15068-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MRFWLRTEEMALEEMVQRLNAVSKHT
     1128-1137: GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQAPFSDLQG

Note: No experimental confirmation available.
Show »
Length:1,125
Mass (Da):126,518
Checksum:iAE637064E50647B0
GO
Isoform 8 (identifier: O15068-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MGDGKAVRISVAEMKSYYLYSEWCSWLLSVAE

Show »
Length:1,113
Mass (Da):125,368
Checksum:i9AE182A51542CDE4
GO
Isoform 9 (identifier: O15068-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MTVRRLSLLCRDLWALWLLLKAGA
     1128-1137: GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQAPFSDLQG

Note: No experimental confirmation available.
Show »
Length:1,123
Mass (Da):126,111
Checksum:i3BB27FD875BF70B5
GO

Computationally mapped potential isoform sequencesi

There are 16 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BYP9H7BYP9_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
793Annotation score:
A2A3G7A2A3G7_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
136Annotation score:
H3BLT1H3BLT1_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
296Annotation score:
H0Y4M6H0Y4M6_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
336Annotation score:
A2A640A2A640_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
213Annotation score:
H7C2S1H7C2S1_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
317Annotation score:
H7C275H7C275_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
189Annotation score:
B7ZBR9B7ZBR9_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
136Annotation score:
H0Y7A3H0Y7A3_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
151Annotation score:
A2A639A2A639_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
86Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence BAA20817 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti580C → S in BAG58097 (PubMed:14702039).Curated1
Sequence conflicti660E → G in BAG58097 (PubMed:14702039).Curated1
Sequence conflicti721F → L in BAG58528 (PubMed:14702039).Curated1
Sequence conflicti1052P → L in BAG58528 (PubMed:14702039).Curated1
Sequence conflicti1123C → R in BAG58097 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0261191 – 189Missing in isoform 5. 1 PublicationAdd BLAST189
Alternative sequenceiVSP_0261201 – 56MFDCW…TAMAT → MPLRGGAGPSPASHGPTHGP SDPRTCLPGRGAGGMRPHGR GALGCCGLCSFYTCHGAAG in isoform 2. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_0261211 – 56MFDCW…TAMAT → MAEKGASRGTLRRLWSLPRR RRGTAGRSRP in isoform 3. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_0261221 – 56MFDCW…TAMAT → MTVRRLSLLCRDLWALWLLL KAGA in isoform 4 and isoform 9. 2 PublicationsAdd BLAST56
Alternative sequenceiVSP_0261231 – 56MFDCW…TAMAT → MRFWLRTEEMALEEMVQRLN AVSKHT in isoform 6 and isoform 7. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_0261241 – 56MFDCW…TAMAT → MGDGKAVRISVAEMKSYYLY SEWCSWLLSVAE in isoform 8. CuratedAdd BLAST56
Alternative sequenceiVSP_0261261015 – 1016GW → EP in isoform 4. 1 Publication2
Alternative sequenceiVSP_0261271017 – 1137Missing in isoform 4. 1 PublicationAdd BLAST121
Alternative sequenceiVSP_0261281094 – 1137Missing in isoform 2, isoform 3 and isoform 5. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_0390371128 – 1137GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQ APFSDLQG in isoform 7 and isoform 9. 1 Publication10

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB116074 mRNA Translation: BAD08351.1
AB116075 mRNA Translation: BAD08352.1
AB002360 mRNA Translation: BAA20817.1 Different initiation.
AK295047 mRNA Translation: BAG58097.1
AK295670 mRNA Translation: BAG58528.1
AL356740 Genomic DNA No translation available.
AL596093 Genomic DNA No translation available.
AL162454 Genomic DNA No translation available.
AL137002 Genomic DNA No translation available.
BC011853 mRNA Translation: AAH11853.1
BC020208 mRNA Translation: AAH20208.1
CCDSiCCDS45070.2 [O15068-9]
CCDS81782.1 [O15068-4]
CCDS9527.3 [O15068-10]
RefSeqiNP_001106203.2, NM_001112732.2 [O15068-9]
NP_001307744.1, NM_001320815.1
NP_001307745.1, NM_001320816.1
NP_001307746.1, NM_001320817.1 [O15068-4]
NP_079255.4, NM_024979.4 [O15068-10]
UniGeneiHs.170422

Genome annotation databases

EnsembliENST00000375597; ENSP00000364747; ENSG00000126217 [O15068-4]
ENST00000375604; ENSP00000364754; ENSG00000126217 [O15068-10]
ENST00000375608; ENSP00000364758; ENSG00000126217 [O15068-1]
ENST00000397030; ENSP00000380225; ENSG00000126217 [O15068-2]
ENST00000421756; ENSP00000397285; ENSG00000126217 [O15068-3]
ENST00000535094; ENSP00000440374; ENSG00000126217 [O15068-9]
GeneIDi23263
KEGGihsa:23263
UCSCiuc001vss.5 human [O15068-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB116074 mRNA Translation: BAD08351.1
AB116075 mRNA Translation: BAD08352.1
AB002360 mRNA Translation: BAA20817.1 Different initiation.
AK295047 mRNA Translation: BAG58097.1
AK295670 mRNA Translation: BAG58528.1
AL356740 Genomic DNA No translation available.
AL596093 Genomic DNA No translation available.
AL162454 Genomic DNA No translation available.
AL137002 Genomic DNA No translation available.
BC011853 mRNA Translation: AAH11853.1
BC020208 mRNA Translation: AAH20208.1
CCDSiCCDS45070.2 [O15068-9]
CCDS81782.1 [O15068-4]
CCDS9527.3 [O15068-10]
RefSeqiNP_001106203.2, NM_001112732.2 [O15068-9]
NP_001307744.1, NM_001320815.1
NP_001307745.1, NM_001320816.1
NP_001307746.1, NM_001320817.1 [O15068-4]
NP_079255.4, NM_024979.4 [O15068-10]
UniGeneiHs.170422

3D structure databases

ProteinModelPortaliO15068
SMRiO15068
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116865, 10 interactors
IntActiO15068, 6 interactors
MINTiO15068
STRINGi9606.ENSP00000440374

Chemistry databases

SwissLipidsiSLP:000001547

PTM databases

iPTMnetiO15068
PhosphoSitePlusiO15068

Polymorphism and mutation databases

BioMutaiMCF2L

Proteomic databases

EPDiO15068
MaxQBiO15068
PaxDbiO15068
PeptideAtlasiO15068
PRIDEiO15068
ProteomicsDBi48418
48419 [O15068-2]
48420 [O15068-3]
48421 [O15068-4]
48422 [O15068-5]
48423 [O15068-6]
48424 [O15068-8]
48425 [O15068-9]

Protocols and materials databases

DNASUi23263
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375597; ENSP00000364747; ENSG00000126217 [O15068-4]
ENST00000375604; ENSP00000364754; ENSG00000126217 [O15068-10]
ENST00000375608; ENSP00000364758; ENSG00000126217 [O15068-1]
ENST00000397030; ENSP00000380225; ENSG00000126217 [O15068-2]
ENST00000421756; ENSP00000397285; ENSG00000126217 [O15068-3]
ENST00000535094; ENSP00000440374; ENSG00000126217 [O15068-9]
GeneIDi23263
KEGGihsa:23263
UCSCiuc001vss.5 human [O15068-1]

Organism-specific databases

CTDi23263
DisGeNETi23263
EuPathDBiHostDB:ENSG00000126217.20
GeneCardsiMCF2L
HGNCiHGNC:14576 MCF2L
MIMi609499 gene
neXtProtiNX_O15068
OpenTargetsiENSG00000126217
PharmGKBiPA30685
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IPNH Eukaryota
ENOG410XNYV LUCA
GeneTreeiENSGT00930000150837
HOGENOMiHOG000231361
HOVERGENiHBG062385
InParanoidiO15068
KOiK20685
OMAiWYVRNLT
OrthoDBiEOG091G04A2
PhylomeDBiO15068
TreeFamiTF318080

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events

Miscellaneous databases

ChiTaRSiMCF2L human
GeneWikiiMCF2L
GenomeRNAii23263
PROiPR:O15068
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000126217 Expressed in 195 organ(s), highest expression level in right hemisphere of cerebellum
ExpressionAtlasiO15068 baseline and differential
GenevisibleiO15068 HS

Family and domain databases

CDDicd01227 PH_Dbs, 1 hit
cd00160 RhoGEF, 1 hit
cd00170 SEC14, 1 hit
cd11857 SH3_DBS, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR001251 CRAL-TRIO_dom
IPR036865 CRAL-TRIO_dom_sf
IPR035899 DBL_dom_sf
IPR035534 DBS_PH
IPR035532 DBS_SH3
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR018159 Spectrin/alpha-actinin
IPR002017 Spectrin_repeat
PfamiView protein in Pfam
PF13716 CRAL_TRIO_2, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF07653 SH3_2, 1 hit
PF00435 Spectrin, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00516 SEC14, 1 hit
SM00326 SH3, 1 hit
SM00150 SPEC, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 1 hit
SSF52087 SSF52087, 1 hit
PROSITEiView protein in PROSITE
PS50191 CRAL_TRIO, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50002 SH3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMCF2L_HUMAN
AccessioniPrimary (citable) accession number: O15068
Secondary accession number(s): A2A2X1
, A2A2X2, A2A3G6, A2A3G8, B4DHD6, B4DIL6, E9PDN8, Q5JU56, Q5VXT1, Q6ZWD4, Q765G8, Q765G9, Q8N679
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 12, 2007
Last modified: November 7, 2018
This is version 176 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again