Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Guanine nucleotide exchange factor DBS

Gene

MCF2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Guanine nucleotide exchange factor that catalyzes guanine nucleotide exchange on RHOA and CDC42, and thereby contributes to the regulation of RHOA and CDC42 signaling pathways (By similarity). Seems to lack activity with RAC1. Becomes activated and highly tumorigenic by truncation of the N-terminus (By similarity). Isoform 5 activates CDC42 (PubMed:15157669).By similarity1 Publication
Isoform 3: Does not catalyze guanine nucleotide exchange on CDC42 (PubMed:15157669).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor
LigandLipid-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000001547

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Guanine nucleotide exchange factor DBS
Alternative name(s):
DBL's big sister
MCF2-transforming sequence-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MCF2L
Synonyms:KIAA0362, OST1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000126217.20

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14576 MCF2L

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609499 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15068

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
23263

Open Targets

More...
OpenTargetsi
ENSG00000126217

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30685

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MCF2L

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000809351 – 1137Guanine nucleotide exchange factor DBSAdd BLAST1137

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei457PhosphoserineBy similarity1
Modified residuei480PhosphoserineBy similarity1
Modified residuei620PhosphoserineBy similarity1
Modified residuei1033PhosphoserineBy similarity1
Modified residuei1034PhosphoserineBy similarity1
Modified residuei1041PhosphoserineBy similarity1
Modified residuei1042PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O15068

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O15068

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O15068

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O15068

PeptideAtlas

More...
PeptideAtlasi
O15068

PRoteomics IDEntifications database

More...
PRIDEi
O15068

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48418
48419 [O15068-2]
48420 [O15068-3]
48421 [O15068-4]
48422 [O15068-5]
48423 [O15068-6]
48424 [O15068-8]
48425 [O15068-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15068

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15068

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000126217 Expressed in 195 organ(s), highest expression level in right hemisphere of cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O15068 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15068 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GTP-bound RAC1 (By similarity). Interacts with CDC42 (PubMed:15157669). Interacts with RHOA. Interacts with CCPG1, which results in specific inhibition of its exchange activity toward RHOA, but does not affect its activity on CDC42 (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116865, 11 interactors

Protein interaction database and analysis system

More...
IntActi
O15068, 6 interactors

Molecular INTeraction database

More...
MINTi
O15068

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000440374

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O15068

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O15068

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini52 – 224CRAL-TRIOPROSITE-ProRule annotationAdd BLAST173
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati351 – 456SpectrinAdd BLAST106
Domaini631 – 811DHPROSITE-ProRule annotationAdd BLAST181
Domaini829 – 945PHPROSITE-ProRule annotationAdd BLAST117
Domaini1055 – 1116SH3PROSITE-ProRule annotationAdd BLAST62

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili503 – 529Sequence analysisAdd BLAST27

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The CRAL-TRIO domain mediates interaction with various inositol phospholipids, such as phosphatidylinositol 3-phosphate (PI3P), phosphatidylinositol 4-phosphate (PI4P) and phosphatidylinositol 5-phosphate (PI5P).1 Publication
The DH domain is involved in interaction with CCPG1.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MCF2 family.Curated

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IPNH Eukaryota
ENOG410XNYV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157874

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231361

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG062385

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15068

KEGG Orthology (KO)

More...
KOi
K20685

Identification of Orthologs from Complete Genome Data

More...
OMAi
WYVRNLT

Database of Orthologous Groups

More...
OrthoDBi
118479at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O15068

TreeFam database of animal gene trees

More...
TreeFami
TF318080

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01227 PH_Dbs, 1 hit
cd00160 RhoGEF, 1 hit
cd00170 SEC14, 1 hit
cd11857 SH3_DBS, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.900.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001251 CRAL-TRIO_dom
IPR036865 CRAL-TRIO_dom_sf
IPR035899 DBL_dom_sf
IPR035534 DBS_PH
IPR035532 DBS_SH3
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR018159 Spectrin/alpha-actinin
IPR002017 Spectrin_repeat

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13716 CRAL_TRIO_2, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF00435 Spectrin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00516 SEC14, 1 hit
SM00326 SH3, 1 hit
SM00150 SPEC, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 1 hit
SSF52087 SSF52087, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50191 CRAL_TRIO, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: A number of isoforms are produced. According to EST sequences. Experimental confirmation may be lacking for some isoforms.

This entry has 9 described isoforms and 16 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15068-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFDCWRFILC KRPGSNSYSS PQRPNEAKKE ETDHQIDVSD VIRLVQDTPE
60 70 80 90 100
ATAMATDEIM HQDIVPLCAA DIQDQLKKRF AYLSGGRGQD GSPVITFPDY
110 120 130 140 150
PAFSEIPDKE FQNVMTYLTS IPSLQDAGIG FILVIDRRRD KWTSVKASVL
160 170 180 190 200
RIAASFPANL QLVLVLRPTG FFQRTLSDIA FKFNRDDFKM KVPVIMLSSV
210 220 230 240 250
PDLHGYIDKS QLTEDLGGTL DYCHSRWLCQ RTAIESFALM VKQTAQMLQS
260 270 280 290 300
FGTELAETEL PNDVQSTSSV LCAHTEKKDK AKEDLRLALK EGHSVLESLR
310 320 330 340 350
ELQAEGSEPS VNQDQLDNQA TVQRLLAQLN ETEAAFDEFW AKHQQKLEQC
360 370 380 390 400
LQLRHFEQGF REVKAILDAA SQKIATFTDI GNSLAHVEHL LRDLASFEEK
410 420 430 440 450
SGVAVERARA LSLDGEQLIG NKHYAVDSIR PKCQELRHLC DQFSAEIARR
460 470 480 490 500
RGLLSKSLEL HRRLETSMKW CDEGIYLLAS QPVDKCQSQD GAEAALQEIE
510 520 530 540 550
KFLETGAENK IQELNAIYKE YESILNQDLM EHVRKVFQKQ ASMEEVFHRR
560 570 580 590 600
QASLKKLAAR QTRPVQPVAP RPEALAKSPC PSPGIRRGSE NSSSEGGALR
610 620 630 640 650
RGPYRRAKSE MSESRQGRGS AGEEEESLAI LRRHVMSELL DTERAYVEEL
660 670 680 690 700
LCVLEGYAAE MDNPLMAHLL STGLHNKKDV LFGNMEEIYH FHNRIFLREL
710 720 730 740 750
ENYTDCPELV GRCFLERMED FQIYEKYCQN KPRSESLWRQ CSDCPFFQEC
760 770 780 790 800
QRKLDHKLSL DSYLLKPVQR ITKYQLLLKE MLKYSRNCEG AEDLQEALSS
810 820 830 840 850
ILGILKAVND SMHLIAITGY DGNLGDLGKL LMQGSFSVWT DHKRGHTKVK
860 870 880 890 900
ELARFKPMQR HLFLHEKAVL FCKKREENGE GYEKAPSYSY KQSLNMAAVG
910 920 930 940 950
ITENVKGDAK KFEIWYNARE EVYIVQAPTP EIKAAWVNEI RKVLTSQLQA
960 970 980 990 1000
CREASQHRAL EQSQSLPLPA PTSTSPSRGN SRNIKKLEER KTDPLSLEGY
1010 1020 1030 1040 1050
VSSAPLTKPP EKGKGWSKTS HSLEAPEDDG GWSSAEEQIN SSDAEEDGGL
1060 1070 1080 1090 1100
GPKKLVPGKY TVVADHEKGG PDALRVRSGD VVELVQEGDE GLWYVRDPTT
1110 1120 1130
GKEGWVPASS LSVRLGPSGS AQCLSSSGKA HVPRAHP
Note: Gene prediction based on similarity to mouse ortholog.
Length:1,137
Mass (Da):128,109
Last modified:June 12, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB2830890A69C8377
GO
Isoform 2 (identifier: O15068-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MPLRGGAGPS...SFYTCHGAAG
     1094-1137: Missing.

Show »
Length:1,096
Mass (Da):122,895
Checksum:i31D641D6773111D8
GO
Isoform 3 (identifier: O15068-3) [UniParc]FASTAAdd to basket
Also known as: Ost-II1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MAEKGASRGTLRRLWSLPRRRRGTAGRSRP
     1094-1137: Missing.

Show »
Length:1,067
Mass (Da):120,618
Checksum:i2F3F56C9605F5065
GO
Isoform 4 (identifier: O15068-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MTVRRLSLLCRDLWALWLLLKAGA
     1015-1016: GW → EP
     1017-1137: Missing.

Show »
Length:984
Mass (Da):111,862
Checksum:i50B50DCB7CCF0AE1
GO
Isoform 5 (identifier: O15068-5) [UniParc]FASTAAdd to basket
Also known as: Ost-I1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-189: Missing.
     1094-1137: Missing.

Show »
Length:904
Mass (Da):102,175
Checksum:i563456F50829E587
GO
Isoform 6 (identifier: O15068-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MRFWLRTEEMALEEMVQRLNAVSKHT

Show »
Length:1,107
Mass (Da):124,902
Checksum:iEA759E18895EA8A7
GO
Isoform 7 (identifier: O15068-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MRFWLRTEEMALEEMVQRLNAVSKHT
     1128-1137: GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQAPFSDLQG

Note: No experimental confirmation available.
Show »
Length:1,125
Mass (Da):126,518
Checksum:iAE637064E50647B0
GO
Isoform 8 (identifier: O15068-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MGDGKAVRISVAEMKSYYLYSEWCSWLLSVAE

Show »
Length:1,113
Mass (Da):125,368
Checksum:i9AE182A51542CDE4
GO
Isoform 9 (identifier: O15068-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MTVRRLSLLCRDLWALWLLLKAGA
     1128-1137: GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQAPFSDLQG

Note: No experimental confirmation available.
Show »
Length:1,123
Mass (Da):126,111
Checksum:i3BB27FD875BF70B5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 16 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BYP9H7BYP9_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
793Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2A3G7A2A3G7_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2A640A2A640_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
213Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BLT1H3BLT1_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
296Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y4M6H0Y4M6_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
336Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2S1H7C2S1_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
317Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C275H7C275_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZBR9B7ZBR9_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y7A3H0Y7A3_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2A639A2A639_HUMAN
Guanine nucleotide exchange factor ...
MCF2L
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA20817 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti580C → S in BAG58097 (PubMed:14702039).Curated1
Sequence conflicti660E → G in BAG58097 (PubMed:14702039).Curated1
Sequence conflicti721F → L in BAG58528 (PubMed:14702039).Curated1
Sequence conflicti1052P → L in BAG58528 (PubMed:14702039).Curated1
Sequence conflicti1123C → R in BAG58097 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0261191 – 189Missing in isoform 5. 1 PublicationAdd BLAST189
Alternative sequenceiVSP_0261201 – 56MFDCW…TAMAT → MPLRGGAGPSPASHGPTHGP SDPRTCLPGRGAGGMRPHGR GALGCCGLCSFYTCHGAAG in isoform 2. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_0261211 – 56MFDCW…TAMAT → MAEKGASRGTLRRLWSLPRR RRGTAGRSRP in isoform 3. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_0261221 – 56MFDCW…TAMAT → MTVRRLSLLCRDLWALWLLL KAGA in isoform 4 and isoform 9. 2 PublicationsAdd BLAST56
Alternative sequenceiVSP_0261231 – 56MFDCW…TAMAT → MRFWLRTEEMALEEMVQRLN AVSKHT in isoform 6 and isoform 7. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_0261241 – 56MFDCW…TAMAT → MGDGKAVRISVAEMKSYYLY SEWCSWLLSVAE in isoform 8. CuratedAdd BLAST56
Alternative sequenceiVSP_0261261015 – 1016GW → EP in isoform 4. 1 Publication2
Alternative sequenceiVSP_0261271017 – 1137Missing in isoform 4. 1 PublicationAdd BLAST121
Alternative sequenceiVSP_0261281094 – 1137Missing in isoform 2, isoform 3 and isoform 5. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_0390371128 – 1137GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQ APFSDLQG in isoform 7 and isoform 9. 1 Publication10

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB116074 mRNA Translation: BAD08351.1
AB116075 mRNA Translation: BAD08352.1
AB002360 mRNA Translation: BAA20817.1 Different initiation.
AK295047 mRNA Translation: BAG58097.1
AK295670 mRNA Translation: BAG58528.1
AL356740 Genomic DNA No translation available.
AL596093 Genomic DNA No translation available.
AL162454 Genomic DNA No translation available.
AL137002 Genomic DNA No translation available.
BC011853 mRNA Translation: AAH11853.1
BC020208 mRNA Translation: AAH20208.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45070.2 [O15068-9]
CCDS81782.1 [O15068-4]
CCDS9527.3 [O15068-10]

NCBI Reference Sequences

More...
RefSeqi
NP_001106203.2, NM_001112732.2 [O15068-9]
NP_001307744.1, NM_001320815.1
NP_001307745.1, NM_001320816.1
NP_001307746.1, NM_001320817.1 [O15068-4]
NP_079255.4, NM_024979.4 [O15068-10]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.170422

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000375597; ENSP00000364747; ENSG00000126217 [O15068-4]
ENST00000375604; ENSP00000364754; ENSG00000126217 [O15068-10]
ENST00000375608; ENSP00000364758; ENSG00000126217 [O15068-1]
ENST00000397030; ENSP00000380225; ENSG00000126217 [O15068-2]
ENST00000421756; ENSP00000397285; ENSG00000126217 [O15068-3]
ENST00000535094; ENSP00000440374; ENSG00000126217 [O15068-9]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23263

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23263

UCSC genome browser

More...
UCSCi
uc001vss.5 human [O15068-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB116074 mRNA Translation: BAD08351.1
AB116075 mRNA Translation: BAD08352.1
AB002360 mRNA Translation: BAA20817.1 Different initiation.
AK295047 mRNA Translation: BAG58097.1
AK295670 mRNA Translation: BAG58528.1
AL356740 Genomic DNA No translation available.
AL596093 Genomic DNA No translation available.
AL162454 Genomic DNA No translation available.
AL137002 Genomic DNA No translation available.
BC011853 mRNA Translation: AAH11853.1
BC020208 mRNA Translation: AAH20208.1
CCDSiCCDS45070.2 [O15068-9]
CCDS81782.1 [O15068-4]
CCDS9527.3 [O15068-10]
RefSeqiNP_001106203.2, NM_001112732.2 [O15068-9]
NP_001307744.1, NM_001320815.1
NP_001307745.1, NM_001320816.1
NP_001307746.1, NM_001320817.1 [O15068-4]
NP_079255.4, NM_024979.4 [O15068-10]
UniGeneiHs.170422

3D structure databases

ProteinModelPortaliO15068
SMRiO15068
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116865, 11 interactors
IntActiO15068, 6 interactors
MINTiO15068
STRINGi9606.ENSP00000440374

Chemistry databases

SwissLipidsiSLP:000001547

PTM databases

iPTMnetiO15068
PhosphoSitePlusiO15068

Polymorphism and mutation databases

BioMutaiMCF2L

Proteomic databases

EPDiO15068
jPOSTiO15068
MaxQBiO15068
PaxDbiO15068
PeptideAtlasiO15068
PRIDEiO15068
ProteomicsDBi48418
48419 [O15068-2]
48420 [O15068-3]
48421 [O15068-4]
48422 [O15068-5]
48423 [O15068-6]
48424 [O15068-8]
48425 [O15068-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
23263
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375597; ENSP00000364747; ENSG00000126217 [O15068-4]
ENST00000375604; ENSP00000364754; ENSG00000126217 [O15068-10]
ENST00000375608; ENSP00000364758; ENSG00000126217 [O15068-1]
ENST00000397030; ENSP00000380225; ENSG00000126217 [O15068-2]
ENST00000421756; ENSP00000397285; ENSG00000126217 [O15068-3]
ENST00000535094; ENSP00000440374; ENSG00000126217 [O15068-9]
GeneIDi23263
KEGGihsa:23263
UCSCiuc001vss.5 human [O15068-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23263
DisGeNETi23263
EuPathDBiHostDB:ENSG00000126217.20

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MCF2L
HGNCiHGNC:14576 MCF2L
MIMi609499 gene
neXtProtiNX_O15068
OpenTargetsiENSG00000126217
PharmGKBiPA30685

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IPNH Eukaryota
ENOG410XNYV LUCA
GeneTreeiENSGT00940000157874
HOGENOMiHOG000231361
HOVERGENiHBG062385
InParanoidiO15068
KOiK20685
OMAiWYVRNLT
OrthoDBi118479at2759
PhylomeDBiO15068
TreeFamiTF318080

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MCF2L human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MCF2L

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23263

Protein Ontology

More...
PROi
PR:O15068

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000126217 Expressed in 195 organ(s), highest expression level in right hemisphere of cerebellum
ExpressionAtlasiO15068 baseline and differential
GenevisibleiO15068 HS

Family and domain databases

CDDicd01227 PH_Dbs, 1 hit
cd00160 RhoGEF, 1 hit
cd00170 SEC14, 1 hit
cd11857 SH3_DBS, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR001251 CRAL-TRIO_dom
IPR036865 CRAL-TRIO_dom_sf
IPR035899 DBL_dom_sf
IPR035534 DBS_PH
IPR035532 DBS_SH3
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR018159 Spectrin/alpha-actinin
IPR002017 Spectrin_repeat
PfamiView protein in Pfam
PF13716 CRAL_TRIO_2, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF00435 Spectrin, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00516 SEC14, 1 hit
SM00326 SH3, 1 hit
SM00150 SPEC, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 1 hit
SSF52087 SSF52087, 1 hit
PROSITEiView protein in PROSITE
PS50191 CRAL_TRIO, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMCF2L_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15068
Secondary accession number(s): A2A2X1
, A2A2X2, A2A3G6, A2A3G8, B4DHD6, B4DIL6, E9PDN8, Q5JU56, Q5VXT1, Q6ZWD4, Q765G8, Q765G9, Q8N679
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 12, 2007
Last modified: January 16, 2019
This is version 178 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again