Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated serine/threonine-protein kinase 4

Gene

MAST4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Mg2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei599ATPPROSITE-ProRule annotation1
Active sitei693Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi576 – 584ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiO15021

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated serine/threonine-protein kinase 4Curated (EC:2.7.11.1PROSITE-ProRule annotation)
Gene namesi
Name:MAST4Imported
Synonyms:KIAA03031 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000069020.18
HGNCiHGNC:19037 MAST4
neXtProtiNX_O15021

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi375449
OpenTargetsiENSG00000069020
PharmGKBiPA134920494

Chemistry databases

ChEMBLiCHEMBL2417351

Polymorphism and mutation databases

BioMutaiMAST4

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002522561 – 2623Microtubule-associated serine/threonine-protein kinase 4Add BLAST2623

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei206PhosphoserineBy similarity1
Modified residuei213PhosphoserineBy similarity1
Modified residuei270PhosphoserineCombined sources1
Modified residuei914PhosphoserineCombined sources1
Modified residuei1292PhosphoserineBy similarity1
Modified residuei1370PhosphoserineCombined sources1
Modified residuei1384PhosphoserineCombined sources1
Modified residuei1397PhosphoserineBy similarity1
Modified residuei1419PhosphoserineCombined sources1
Modified residuei1467PhosphoserineCombined sources1
Modified residuei1523PhosphoserineCombined sources1
Modified residuei1779PhosphoserineCombined sources1
Modified residuei1822PhosphoserineCombined sources1
Modified residuei1909PhosphoserineCombined sources1
Modified residuei2442PhosphoserineCombined sources1
Modified residuei2520PhosphoserineCombined sources1
Modified residuei2552PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO15021
PaxDbiO15021
PeptideAtlasiO15021
PRIDEiO15021
ProteomicsDBi48378
48380 [O15021-2]
48381 [O15021-3]
48382 [O15021-4]

PTM databases

iPTMnetiO15021
PhosphoSitePlusiO15021

Expressioni

Tissue specificityi

Highly expressed in most normal human tissues, with an exception of in testis, small intestine, colon and peripheral blood leukocyte.1 Publication

Gene expression databases

BgeeiENSG00000069020 Expressed in 234 organ(s), highest expression level in cervix squamous epithelium
CleanExiHS_MAST4
ExpressionAtlasiO15021 baseline and differential
GenevisibleiO15021 HS

Organism-specific databases

HPAiHPA000544

Interactioni

Protein-protein interaction databases

BioGridi131980, 1 interactor
IntActiO15021, 2 interactors
MINTiO15021
STRINGi9606.ENSP00000385727

Structurei

Secondary structure

12623
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO15021
SMRiO15021
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15021

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini570 – 843Protein kinasePROSITE-ProRule annotationAdd BLAST274
Domaini844 – 916AGC-kinase C-terminalAdd BLAST73
Domaini1141 – 1229PDZPROSITE-ProRule annotationAdd BLAST89

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi63 – 108Pro-richPROSITE-ProRule annotationAdd BLAST46
Compositional biasi2125 – 2208Pro-richPROSITE-ProRule annotationAdd BLAST84

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0606 Eukaryota
ENOG410XPWX LUCA
GeneTreeiENSGT00530000063286
HOGENOMiHOG000074100
HOVERGENiHBG108118
InParanoidiO15021
KOiK08789
OMAiECLPGNP
OrthoDBiEOG091G00IH
PhylomeDBiO15021
TreeFamiTF313149

Family and domain databases

CDDicd05609 STKc_MAST, 1 hit
Gene3Di1.20.1480.20, 1 hit
InterProiView protein in InterPro
IPR000961 AGC-kinase_C
IPR011009 Kinase-like_dom_sf
IPR015022 MA_Ser/Thr_Kinase_dom
IPR037711 MAST
IPR023142 MAST_pre-PK_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF08926 DUF1908, 1 hit
PF00595 PDZ, 1 hit
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SM00220 S_TKc, 1 hit
SUPFAMiSSF140482 SSF140482, 1 hit
SSF50156 SSF50156, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS51285 AGC_KINASE_CTER, 1 hit
PS50106 PDZ, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 12 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: O15021-5) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGEKVSEAPE PVPRGCSGHG SRTPASALVA ASSPGASSAE SSSGSETLSE
60 70 80 90 100
EGEPGGFSRE HQPPPPPPLG GTLGARAPAA WAPASVLLER GVLALPPPLP
110 120 130 140 150
GGAVPPAPRG SSASQEEQDE ELDHILSPPP MPFRKCSNPD VASGPGKSLK
160 170 180 190 200
YKRQLSEDGR QLRRGSLGGA LTGRYLLPNP VAGQAWPASA ETSNLVRMRS
210 220 230 240 250
QALGQSAPSL TASLKELSLP RRGSFCRTSN RKSLIGNGQS PALPRPHSPL
260 270 280 290 300
SAHAGNSPQD SPRNFSPSAS AHFSFARRTD GRRWSLASLP SSGYGTNTPS
310 320 330 340 350
STVSSSCSSQ EKLHQLPYQP TPDELHFLSK HFCTTESIAT ENRCRNTPMR
360 370 380 390 400
PRSRSLSPGR SPACCDHEII MMNHVYKERF PKATAQMEER LKEIITSYSP
410 420 430 440 450
DNVLPLADGV LSFTHHQIIE LARDCLDKSH QGLITSRYFL ELQHKLDKLL
460 470 480 490 500
QEAHDRSESG ELAFIKQLVR KILIVIARPA RLLECLEFDP EEFYYLLEAA
510 520 530 540 550
EGHAKEGQGI KTDIPRYIIS QLGLNKDPLE EMAHLGNYDS GTAETPETDE
560 570 580 590 600
SVSSSNASLK LRRKPRESDF ETIKLISNGA YGAVYFVRHK ESRQRFAMKK
610 620 630 640 650
INKQNLILRN QIQQAFVERD ILTFAENPFV VSMYCSFETR RHLCMVMEYV
660 670 680 690 700
EGGDCATLMK NMGPLPVDMA RMYFAETVLA LEYLHNYGIV HRDLKPDNLL
710 720 730 740 750
VTSMGHIKLT DFGLSKVGLM SMTTNLYEGH IEKDAREFLD KQVCGTPEYI
760 770 780 790 800
APEVILRQGY GKPVDWWAMG IILYEFLVGC VPFFGDTPEE LFGQVISDEI
810 820 830 840 850
NWPEKDEAPP PDAQDLITLL LRQNPLERLG TGGAYEVKQH RFFRSLDWNS
860 870 880 890 900
LLRQKAEFIP QLESEDDTSY FDTRSEKYHH METEEEDDTN DEDFNVEIRQ
910 920 930 940 950
FSSCSHRFSK VFSSIDRITQ NSAEEKEDSV DKTKSTTLPS TETLSWSSEY
960 970 980 990 1000
SEMQQLSTSN SSDTESNRHK LSSGLLPKLA ISTEGEQDEA ASCPGDPHEE
1010 1020 1030 1040 1050
PGKPALPPEE CAQEEPEVTT PASTISSSTL SVGSFSEHLD QINGRSECVD
1060 1070 1080 1090 1100
STDNSSKPSS EPASHMARQR LESTEKKKIS GKVTKSLSAS ALSLMIPGDM
1110 1120 1130 1140 1150
FAVSPLGSPM SPHSLSSDPS SSRDSSPSRD SSAASASPHQ PIVIHSSGKN
1160 1170 1180 1190 1200
YGFTIRAIRV YVGDSDIYTV HHIVWNVEEG SPACQAGLKA GDLITHINGE
1210 1220 1230 1240 1250
PVHGLVHTEV IELLLKSGNK VSITTTPFEN TSIKTGPARR NSYKSRMVRR
1260 1270 1280 1290 1300
SKKSKKKESL ERRRSLFKKL AKQPSPLLHT SRSFSCLNRS LSSGESLPGS
1310 1320 1330 1340 1350
PTHSLSPRSP TPSYRSTPDF PSGTNSSQSS SPSSSAPNSP AGSGHIRPST
1360 1370 1380 1390 1400
LHGLAPKLGG QRYRSGRRKS AGNIPLSPLA RTPSPTPQPT SPQRSPSPLL
1410 1420 1430 1440 1450
GHSLGNSKIA QAFPSKMHSP PTIVRHIVRP KSAEPPRSPL LKRVQSEEKL
1460 1470 1480 1490 1500
SPSYGSDKKH LCSRKHSLEV TQEEVQREQS QREAPLQSLD ENVCDVPPLS
1510 1520 1530 1540 1550
RARPVEQGCL KRPVSRKVGR QESVDDLDRD KLKAKVVVKK ADGFPEKQES
1560 1570 1580 1590 1600
HQKSHGPGSD LENFALFKLE EREKKVYPKA VERSSTFENK ASMQEAPPLG
1610 1620 1630 1640 1650
SLLKDALHKQ ASVRASEGAM SDGRVPAEHR QGGGDFRRAP APGTLQDGLC
1660 1670 1680 1690 1700
HSLDRGISGK GEGTEKSSQA KELLRCEKLD SKLANIDYLR KKMSLEDKED
1710 1720 1730 1740 1750
NLCPVLKPKM TAGSHECLPG NPVRPTGGQQ EPPPASESRA FVSSTHAAQM
1760 1770 1780 1790 1800
SAVSFVPLKA LTGRVDSGTE KPGLVAPESP VRKSPSEYKL EGRSVSCLKP
1810 1820 1830 1840 1850
IEGTLDIALL SGPQASKTEL PSPESAQSPS PSGDVRASVP PVLPSSSGKK
1860 1870 1880 1890 1900
NDTTSARELS PSSLKMNKSY LLEPWFLPPS RGLQNSPAVS LPDPEFKRDR
1910 1920 1930 1940 1950
KGPHPTARSP GTVMESNPQQ REGSSPKHQD HTTDPKLLTC LGQNLHSPDL
1960 1970 1980 1990 2000
ARPRCPLPPE ASPSREKPGL RESSERGPPT ARSERSAARA DTCREPSMEL
2010 2020 2030 2040 2050
CFPETAKTSD NSKNLLSVGR THPDFYTQTQ AMEKAWAPGG KTNHKDGPGE
2060 2070 2080 2090 2100
ARPPPRDNSS LHSAGIPCEK ELGKVRRGVE PKPEALLARR SLQPPGIESE
2110 2120 2130 2140 2150
KSEKLSSFPS LQKDGAKEPE RKEQPLQRHP SSIPPPPLTA KDLSSPAARQ
2160 2170 2180 2190 2200
HCSSPSHASG REPGAKPSTA EPSSSPQDPP KPVAAHSESS SHKPRPGPDP
2210 2220 2230 2240 2250
GPPKTKHPDR SLSSQKPSVG ATKGKEPATQ SLGGSSREGK GHSKSGPDVF
2260 2270 2280 2290 2300
PATPGSQNKA SDGIGQGEGG PSVPLHTDRA PLDAKPQPTS GGRPLEVLEK
2310 2320 2330 2340 2350
PVHLPRPGHP GPSEPADQKL SAVGEKQTLS PKHPKPSTVK DCPTLCKQTD
2360 2370 2380 2390 2400
NRQTDKSPSQ PAANTDRRAE GKKCTEALYA PAEGDKLEAG LSFVHSENRL
2410 2420 2430 2440 2450
KGAERPAAGV GKGFPEARGK GPGPQKPPTE ADKPNGMKRS PSATGQSSFR
2460 2470 2480 2490 2500
STALPEKSLS CSSSFPETRA GVREASAASS DTSSAKAAGG MLELPAPSNR
2510 2520 2530 2540 2550
DHRKAQPAGE GRTHMTKSDS LPSFRVSTLP LESHHPDPNT MGGASHRDRA
2560 2570 2580 2590 2600
LSVTATVGET KGKDPAPAQP PPARKQNVGR DVTKPSPAPN TDRPISLSNE
2610 2620
KDFVVRQRRG KESLRSSPHK KAL
Length:2,623
Mass (Da):284,097
Last modified:March 28, 2018 - v4
Checksum:i983747097AC218E7
GO
Isoform 2 (identifier: O15021-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSF → MDMSDPNFWTVLSNFTLPHLRSGNRLRRTQS

Note: No experimental confirmation available.
Show »
Length:2,429
Mass (Da):264,762
Checksum:i522EC091B431DA62
GO
Isoform 4 (identifier: O15021-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     225-250: FCRTSNRKSLIGNGQSPALPRPHSPL → LIDSQKWNCLVKRPVCPNAGRTSPLG
     251-2623: Missing.

Note: No experimental confirmation available.
Show »
Length:250
Mass (Da):25,702
Checksum:i8CAF56901F60C75F
GO
Isoform 3 (identifier: O15021-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSF → MDESSILRRR...SQKWNCLVKR

Note: No experimental confirmation available.
Show »
Length:2,434
Mass (Da):265,354
Checksum:i7BE938C15BAA4014
GO
Isoform 5 (identifier: O15021-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSF → MKAQRERLQI...SPLLAFHFWS
     277-277: R → RRND

Show »
Length:2,444
Mass (Da):266,190
Checksum:iC2B2715350203353
GO

Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RAK1D6RAK1_HUMAN
Microtubule-associated serine/threo...
MAST4
350Annotation score:
F8WBH1F8WBH1_HUMAN
Microtubule-associated serine/threo...
MAST4
166Annotation score:
C9J249C9J249_HUMAN
Microtubule-associated serine/threo...
MAST4
167Annotation score:
H7C3S4H7C3S4_HUMAN
Microtubule-associated serine/threo...
MAST4
122Annotation score:
E7EX28E7EX28_HUMAN
Microtubule-associated serine/threo...
MAST4
238Annotation score:
H7C1I9H7C1I9_HUMAN
Microtubule-associated serine/threo...
MAST4
1,680Annotation score:
H7C2V7H7C2V7_HUMAN
Microtubule-associated serine/threo...
MAST4
99Annotation score:
H7C0U3H7C0U3_HUMAN
Microtubule-associated serine/threo...
MAST4
80Annotation score:
H7C2A9H7C2A9_HUMAN
Microtubule-associated serine/threo...
MAST4
58Annotation score:
H7C146H7C146_HUMAN
Microtubule-associated serine/threo...
MAST4
66Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence AK131421 differs from that shown. Reason: Frameshift at position 683.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti350R → H in AK131421 (PubMed:14702039).Curated1
Sequence conflicti662M → T in AK131421 (PubMed:14702039).Curated1
Sequence conflicti674 – 678FAETV → YIVKL in BAB71532 (PubMed:14702039).Curated5
Sequence conflicti1624R → P in AAW52510 (PubMed:17086981).Curated1
Sequence conflicti1624R → P in BAA20762 (PubMed:9205841).Curated1
Sequence conflicti1799K → E in AAW52510 (PubMed:17086981).Curated1
Sequence conflicti1799K → E in BAA20762 (PubMed:9205841).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05976877A → P. Corresponds to variant dbSNP:rs6867856Ensembl.1
Natural variantiVAR_040787920Q → R1 Publication1
Natural variantiVAR_0407881954R → W1 Publication1
Natural variantiVAR_0407892198P → L1 PublicationCorresponds to variant dbSNP:rs752429440Ensembl.1
Natural variantiVAR_0407902290S → C1 Publication1
Natural variantiVAR_0407912467E → D in a lung squamous cell carcinoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0208881 – 225MGEKV…RRGSF → MDMSDPNFWTVLSNFTLPHL RSGNRLRRTQS in isoform 2. 1 PublicationAdd BLAST225
Alternative sequenceiVSP_0231091 – 225MGEKV…RRGSF → MDESSILRRRGLQKELSLPR RGSLIDSQKWNCLVKR in isoform 3. 1 PublicationAdd BLAST225
Alternative sequenceiVSP_0593731 – 225MGEKV…RRGSF → MKAQRERLQIPGLTLDLTPR SLSPTPSSPGSPCSPLLAFH FWS in isoform 5. 1 PublicationAdd BLAST225
Alternative sequenceiVSP_035852225 – 250FCRTS…PHSPL → LIDSQKWNCLVKRPVCPNAG RTSPLG in isoform 4. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_035853251 – 2623Missing in isoform 4. 1 PublicationAdd BLAST2373
Alternative sequenceiVSP_059374277R → RRND in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY830839 mRNA Translation: AAW52510.1
AC008872 Genomic DNA No translation available.
AC008920 Genomic DNA No translation available.
AC016634 Genomic DNA No translation available.
AC034208 Genomic DNA No translation available.
AC044799 Genomic DNA No translation available.
AC092349 Genomic DNA No translation available.
AC092373 Genomic DNA No translation available.
AC113365 Genomic DNA No translation available.
KC877001 Genomic DNA No translation available.
KC877010 Genomic DNA No translation available.
BC033215 mRNA Translation: AAH33215.1
AK057601 mRNA Translation: BAB71532.1
AK131421 mRNA No translation available.
AB002301 mRNA Translation: BAA20762.1
CCDSiCCDS47224.1 [O15021-4]
CCDS47225.1 [O15021-3]
CCDS54861.1 [O15021-5]
CCDS75254.1 [O15021-2]
RefSeqiNP_001158136.1, NM_001164664.1 [O15021-5]
NP_001277155.1, NM_001290226.1
NP_001277157.1, NM_001290228.1
NP_001284580.1, NM_001297651.1 [O15021-2]
NP_055998.1, NM_015183.2 [O15021-3]
NP_942123.1, NM_198828.2 [O15021-4]
XP_006714669.1, XM_006714606.3 [O15021-2]
UniGeneiHs.595458
Hs.732793

Genome annotation databases

EnsembliENST00000261569; ENSP00000261569; ENSG00000069020 [O15021-2]
ENST00000403625; ENSP00000385727; ENSG00000069020 [O15021-5]
ENST00000403666; ENSP00000384313; ENSG00000069020 [O15021-3]
ENST00000405643; ENSP00000384099; ENSG00000069020 [O15021-6]
ENST00000406374; ENSP00000385088; ENSG00000069020 [O15021-4]
GeneIDi375449
KEGGihsa:375449
UCSCiuc003jur.5 human [O15021-5]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY830839 mRNA Translation: AAW52510.1
AC008872 Genomic DNA No translation available.
AC008920 Genomic DNA No translation available.
AC016634 Genomic DNA No translation available.
AC034208 Genomic DNA No translation available.
AC044799 Genomic DNA No translation available.
AC092349 Genomic DNA No translation available.
AC092373 Genomic DNA No translation available.
AC113365 Genomic DNA No translation available.
KC877001 Genomic DNA No translation available.
KC877010 Genomic DNA No translation available.
BC033215 mRNA Translation: AAH33215.1
AK057601 mRNA Translation: BAB71532.1
AK131421 mRNA No translation available.
AB002301 mRNA Translation: BAA20762.1
CCDSiCCDS47224.1 [O15021-4]
CCDS47225.1 [O15021-3]
CCDS54861.1 [O15021-5]
CCDS75254.1 [O15021-2]
RefSeqiNP_001158136.1, NM_001164664.1 [O15021-5]
NP_001277155.1, NM_001290226.1
NP_001277157.1, NM_001290228.1
NP_001284580.1, NM_001297651.1 [O15021-2]
NP_055998.1, NM_015183.2 [O15021-3]
NP_942123.1, NM_198828.2 [O15021-4]
XP_006714669.1, XM_006714606.3 [O15021-2]
UniGeneiHs.595458
Hs.732793

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2W7RX-ray1.60A/B1140-1231[»]
ProteinModelPortaliO15021
SMRiO15021
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131980, 1 interactor
IntActiO15021, 2 interactors
MINTiO15021
STRINGi9606.ENSP00000385727

Chemistry databases

ChEMBLiCHEMBL2417351

PTM databases

iPTMnetiO15021
PhosphoSitePlusiO15021

Polymorphism and mutation databases

BioMutaiMAST4

Proteomic databases

MaxQBiO15021
PaxDbiO15021
PeptideAtlasiO15021
PRIDEiO15021
ProteomicsDBi48378
48380 [O15021-2]
48381 [O15021-3]
48382 [O15021-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261569; ENSP00000261569; ENSG00000069020 [O15021-2]
ENST00000403625; ENSP00000385727; ENSG00000069020 [O15021-5]
ENST00000403666; ENSP00000384313; ENSG00000069020 [O15021-3]
ENST00000405643; ENSP00000384099; ENSG00000069020 [O15021-6]
ENST00000406374; ENSP00000385088; ENSG00000069020 [O15021-4]
GeneIDi375449
KEGGihsa:375449
UCSCiuc003jur.5 human [O15021-5]

Organism-specific databases

CTDi375449
DisGeNETi375449
EuPathDBiHostDB:ENSG00000069020.18
GeneCardsiMAST4
H-InvDBiHIX0004913
HIX0164541
HGNCiHGNC:19037 MAST4
HPAiHPA000544
neXtProtiNX_O15021
OpenTargetsiENSG00000069020
PharmGKBiPA134920494
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0606 Eukaryota
ENOG410XPWX LUCA
GeneTreeiENSGT00530000063286
HOGENOMiHOG000074100
HOVERGENiHBG108118
InParanoidiO15021
KOiK08789
OMAiECLPGNP
OrthoDBiEOG091G00IH
PhylomeDBiO15021
TreeFamiTF313149

Enzyme and pathway databases

SignaLinkiO15021

Miscellaneous databases

ChiTaRSiMAST4 human
EvolutionaryTraceiO15021
GenomeRNAii375449
PROiPR:O15021

Gene expression databases

BgeeiENSG00000069020 Expressed in 234 organ(s), highest expression level in cervix squamous epithelium
CleanExiHS_MAST4
ExpressionAtlasiO15021 baseline and differential
GenevisibleiO15021 HS

Family and domain databases

CDDicd05609 STKc_MAST, 1 hit
Gene3Di1.20.1480.20, 1 hit
InterProiView protein in InterPro
IPR000961 AGC-kinase_C
IPR011009 Kinase-like_dom_sf
IPR015022 MA_Ser/Thr_Kinase_dom
IPR037711 MAST
IPR023142 MAST_pre-PK_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF08926 DUF1908, 1 hit
PF00595 PDZ, 1 hit
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SM00220 S_TKc, 1 hit
SUPFAMiSSF140482 SSF140482, 1 hit
SSF50156 SSF50156, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS51285 AGC_KINASE_CTER, 1 hit
PS50106 PDZ, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMAST4_HUMAN
AccessioniPrimary (citable) accession number: O15021
Secondary accession number(s): A6NL49
, B5ME48, E7EWQ5, J3QT34, Q05EE6, Q6ZN07, Q8N4X4, Q96LY3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: March 28, 2018
Last modified: September 12, 2018
This is version 151 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again