Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O14986 (PI51B_HUMAN)

Entry version 156 (02 Jun 2021)
Sequence version 2 (25 Oct 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Phosphatidylinositol 4-phosphate 5-kinase type-1 beta

Gene

PIP5K1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns4P/PI4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2/PIP2), a lipid second messenger that regulates several cellular processes such as signal transduction, vesicle trafficking, actin cytoskeleton dynamics, cell adhesion, and cell motility (By similarity).

PtdIns(4,5)P2 can directly act as a second messenger or can be utilized as a precursor to generate other second messengers: inositol 1,4,5-trisphosphate (IP3), diacylglycerol (DAG) or phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3/PIP3) (By similarity).

Mediates RAC1-dependent reorganization of actin filaments. Contributes to the activation of phospholipase PLD2. Together with PIP5K1A, is required, after stimulation by G-protein coupled receptors, for the synthesis of IP3 that will induce stable platelet adhesion (By similarity).

By similarity

Caution

There is confusion in the literature with phosphatidylinositol 4-phosphate 5-kinase type I nomenclature due to the fact that frequently mouse PIP5K1B is named Phosphatidylinositol 4-phosphate 5-kinase type I alpha.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS02982-MONOMER

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O14986

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1660499, Synthesis of PIPs at the plasma membrane
R-HSA-201688, WNT mediated activation of DVL
R-HSA-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		O14986

SIGNOR Signaling Network Open Resource

More...SIGNORi		O14986

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphatidylinositol 4-phosphate 5-kinase type-1 beta1 Publication (EC:2.7.1.68By similarity)
Short name:
PIP5K1-beta1 Publication
Short name:
PtdIns(4)P-5-kinase 1 beta1 Publication
Alternative name(s):
Phosphatidylinositol 4-phosphate 5-kinase type I beta1 Publication
Short name:
PIP5KIbeta1 Publication
Protein STM-71 Publication
Type I phosphatidylinositol 4-phosphate 5-kinase beta1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PIP5K1BImported
Synonyms:STM71 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:8995, PIP5K1B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602745, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O14986

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000107242.17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		8395

Open Targets

More...OpenTargetsi		ENSG00000107242

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33328

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O14986, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PIP5K1B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001854581 – 540Phosphatidylinositol 4-phosphate 5-kinase type-1 betaAdd BLAST540

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei445PhosphoserineBy similarity1
Modified residuei447PhosphoserineBy similarity1
Modified residuei448PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O14986

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O14986

MaxQB - The MaxQuant DataBase

More...MaxQBi		O14986

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O14986

PeptideAtlas

More...PeptideAtlasi		O14986

PRoteomics IDEntifications database

More...PRIDEi		O14986

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		4304
48360 [O14986-1]
48361 [O14986-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O14986

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O14986

SwissPalm database of S-palmitoylation events

More...SwissPalmi		O14986

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in heart, pancreas, brain, kidney, skeletal muscle and lung.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000107242, Expressed in choroid plexus epithelium and 208 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O14986, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O14986, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000107242, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RAC1, AJUBA, PLD1, PLD2 and ARF1.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113984, 7 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O14986

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000265382

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O14986, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O14986

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini25 – 395PIPKPROSITE-ProRule annotationAdd BLAST371

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 21DisorderedSequence analysisAdd BLAST21

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0229, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156639

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_004312_5_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O14986

Identification of Orthologs from Complete Genome Data

More...OMAi		ACPTYKD

Database of Orthologous Groups

More...OrthoDBi		1562683at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O14986

TreeFam database of animal gene trees

More...TreeFami		TF319618

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.800.10, 1 hit
3.30.810.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR023610, PInositol-4-P-5-kinase
IPR027483, PInositol-4-P-5-kinase_C
IPR002498, PInositol-4-P-5-kinase_core
IPR027484, PInositol-4-P-5-kinase_N

The PANTHER Classification System

More...PANTHERi		PTHR23086, PTHR23086, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01504, PIP5K, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00330, PIPKc, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51455, PIPK, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O14986-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSAAENGEA APGKQNEEKT YKKTASSAIK GAIQLGIGYT VGNLTSKPER 
        60         70         80         90        100
DVLMQDFYVV ESVFLPSEGS NLTPAHHYPD FRFKTYAPLA FRYFRELFGI 
       110        120        130        140        150
KPDDYLYSIC SEPLIELSNP GASGSLFFVT SDDEFIIKTV QHKEAEFLQK 
       160        170        180        190        200
LLPGYYMNLN QNPRTLLPKF YGLYCMQSGG INIRIVVMNN VLPRSMRMHF 
       210        220        230        240        250
TYDLKGSTYK RRASRKEREK SNPTFKDLDF LQDMHEGLYF DTETYNALMK 
       260        270        280        290        300
TLQRDCRVLE SFKIMDYSLL LGIHFLDHSL KEKEEETPQN VPDAKRTGMQ 
       310        320        330        340        350
KVLYSTAMES IQGPGKSGDG IITENPDTMG GIPAKSHRGE KLLLFMGIID 
       360        370        380        390        400
ILQSYRLMKK LEHSWKALVY DGDTVSVHRP SFYADRFLKF MNSRVFKKIQ 
       410        420        430        440        450
ALKASPSKKR CNSIAALKAT SQEIVSSISQ EWKDEKRDLL TEGQSFSSLD 
       460        470        480        490        500
EEALGSRHRP DLVPSTPSLF EAASLATTIS SSSLYVNEHY PHDRPTLYSN 
       510        520        530        540
SKGLPSSSTF TLEEGTIYLT AEPNTLEVQD DNASVLDVYL
Length:540
Mass (Da):61,036
Last modified:October 25, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7A683794A39A20B6
GO
Isoform 2 (identifier: O14986-2) [UniParc]FASTAAdd to basket
Also known as: Isoform 1

The sequence of this isoform differs from the canonical sequence as follows:
     24-24: T → TQVKNQILSRLPKIPCTFIQAWTNTEMITLLACYYFRSVST
     501-540: SKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL → RFKMATSEH

Show »
Length:549
Mass (Da):62,485
Checksum:iB12247947FAAB6B1
GO
Isoform 3 (identifier: O14986-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     503-540: Missing.

Show »
Length:502
Mass (Da):56,951
Checksum:iCC7A35788CB772F2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MSP5A0A0A0MSP5_HUMAN
Phosphatidylinositol 4-phosphate 5-...
PIP5K1B
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MT25A0A0A0MT25_HUMAN
Phosphatidylinositol 4-phosphate 5-...
PIP5K1B
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRU3A0A0A0MRU3_HUMAN
Phosphatidylinositol 4-phosphate 5-...
PIP5K1B
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti346M → T in AAH30587 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_023712415A → T1 PublicationCorresponds to variant dbSNP:rs55897616Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01601024T → TQVKNQILSRLPKIPCTFIQ AWTNTEMITLLACYYFRSVS T in isoform 2. 1 Publication1
Alternative sequenceiVSP_016011501 – 540SKGLP…LDVYL → RFKMATSEH in isoform 2. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_054771503 – 540Missing in isoform 3. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X92493 mRNA Translation: CAA63224.1
U52387 U52386 Genomic DNA Translation: AAC51327.1
AK292734 mRNA Translation: BAF85423.1
AK295587 mRNA Translation: BAG58479.1
AL162730 Genomic DNA No translation available.
AL354794 Genomic DNA No translation available.
AL356219 Genomic DNA No translation available.
CH471089 Genomic DNA Translation: EAW62465.1
BC030587 mRNA Translation: AAH30587.1
U78580 mRNA Translation: AAC50915.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS65063.1 [O14986-3]
CCDS6624.1 [O14986-1]

NCBI Reference Sequences

More...RefSeqi		NP_001265182.1, NM_001278253.1 [O14986-3]
NP_003549.1, NM_003558.3 [O14986-1]
XP_005252318.1, XM_005252261.3
XP_005252319.1, XM_005252262.4 [O14986-1]
XP_006717363.1, XM_006717300.2
XP_006717364.1, XM_006717301.1
XP_011517384.1, XM_011519082.2 [O14986-1]
XP_011517385.1, XM_011519083.2 [O14986-1]
XP_011517386.1, XM_011519084.2 [O14986-1]
XP_016870677.1, XM_017015188.1 [O14986-1]
XP_016870678.1, XM_017015189.1 [O14986-1]
XP_016870679.1, XM_017015190.1
XP_016870680.1, XM_017015191.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000265382; ENSP00000265382; ENSG00000107242 [O14986-1]
ENST00000478500; ENSP00000435778; ENSG00000107242 [O14986-2]
ENST00000541509; ENSP00000438082; ENSG00000107242 [O14986-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8395

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8395

UCSC genome browser

More...UCSCi		uc004agu.5, human [O14986-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X92493 mRNA Translation: CAA63224.1
U52387 U52386 Genomic DNA Translation: AAC51327.1
AK292734 mRNA Translation: BAF85423.1
AK295587 mRNA Translation: BAG58479.1
AL162730 Genomic DNA No translation available.
AL354794 Genomic DNA No translation available.
AL356219 Genomic DNA No translation available.
CH471089 Genomic DNA Translation: EAW62465.1
BC030587 mRNA Translation: AAH30587.1
U78580 mRNA Translation: AAC50915.1
CCDSiCCDS65063.1 [O14986-3]
CCDS6624.1 [O14986-1]
RefSeqiNP_001265182.1, NM_001278253.1 [O14986-3]
NP_003549.1, NM_003558.3 [O14986-1]
XP_005252318.1, XM_005252261.3
XP_005252319.1, XM_005252262.4 [O14986-1]
XP_006717363.1, XM_006717300.2
XP_006717364.1, XM_006717301.1
XP_011517384.1, XM_011519082.2 [O14986-1]
XP_011517385.1, XM_011519083.2 [O14986-1]
XP_011517386.1, XM_011519084.2 [O14986-1]
XP_016870677.1, XM_017015188.1 [O14986-1]
XP_016870678.1, XM_017015189.1 [O14986-1]
XP_016870679.1, XM_017015190.1
XP_016870680.1, XM_017015191.1

3D structure databases

SMRiO14986
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi113984, 7 interactors
CORUMiO14986
STRINGi9606.ENSP00000265382

PTM databases

iPTMnetiO14986
PhosphoSitePlusiO14986
SwissPalmiO14986

Genetic variation databases

BioMutaiPIP5K1B

Proteomic databases

jPOSTiO14986
MassIVEiO14986
MaxQBiO14986
PaxDbiO14986
PeptideAtlasiO14986
PRIDEiO14986
ProteomicsDBi4304
48360 [O14986-1]
48361 [O14986-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2767, 150 antibodies

The DNASU plasmid repository

More...DNASUi		8395

Genome annotation databases

EnsembliENST00000265382; ENSP00000265382; ENSG00000107242 [O14986-1]
ENST00000478500; ENSP00000435778; ENSG00000107242 [O14986-2]
ENST00000541509; ENSP00000438082; ENSG00000107242 [O14986-3]
GeneIDi8395
KEGGihsa:8395
UCSCiuc004agu.5, human [O14986-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8395
DisGeNETi8395

GeneCards: human genes, protein and diseases

More...GeneCardsi		PIP5K1B
HGNCiHGNC:8995, PIP5K1B
HPAiENSG00000107242, Low tissue specificity
MIMi602745, gene
neXtProtiNX_O14986
OpenTargetsiENSG00000107242
PharmGKBiPA33328
VEuPathDBiHostDB:ENSG00000107242.17

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0229, Eukaryota
GeneTreeiENSGT00940000156639
HOGENOMiCLU_004312_5_1_1
InParanoidiO14986
OMAiACPTYKD
OrthoDBi1562683at2759
PhylomeDBiO14986
TreeFamiTF319618

Enzyme and pathway databases

BioCyciMetaCyc:HS02982-MONOMER
PathwayCommonsiO14986
ReactomeiR-HSA-1660499, Synthesis of PIPs at the plasma membrane
R-HSA-201688, WNT mediated activation of DVL
R-HSA-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
SABIO-RKiO14986
SIGNORiO14986

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8395, 4 hits in 990 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PIP5K1B, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PIP5K1B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8395
PharosiO14986, Tbio

Protein Ontology

More...PROi		PR:O14986
RNActiO14986, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000107242, Expressed in choroid plexus epithelium and 208 other tissues
ExpressionAtlasiO14986, baseline and differential
GenevisibleiO14986, HS

Family and domain databases

Gene3Di3.30.800.10, 1 hit
3.30.810.10, 2 hits
InterProiView protein in InterPro
IPR023610, PInositol-4-P-5-kinase
IPR027483, PInositol-4-P-5-kinase_C
IPR002498, PInositol-4-P-5-kinase_core
IPR027484, PInositol-4-P-5-kinase_N
PANTHERiPTHR23086, PTHR23086, 1 hit
PfamiView protein in Pfam
PF01504, PIP5K, 1 hit
SMARTiView protein in SMART
SM00330, PIPKc, 1 hit
PROSITEiView protein in PROSITE
PS51455, PIPK, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPI51B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O14986
Secondary accession number(s): A8K9L9
, B4DIG7, P78518, P78519, Q5T5K6, Q5T5K8, Q5T5K9, Q5VZ00, Q7KYT5, Q8NHQ5, Q92749
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: October 25, 2005
Last modified: June 2, 2021
This is version 156 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again