Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phosphatidylinositol 4-phosphate 5-kinase type-1 beta

Gene

PIP5K1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Participates in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. Mediates RAC1-dependent reorganization of actin filaments. Contributes to the activation of PLD2. Together with PIP5K1A is required after stimulation of G-protein coupled receptors for stable platelet adhesion (By similarity).By similarity

Caution

There is confusion in the literature with phosphatidylinositol 4-phosphate 5-kinase type I nomenclature due to the fact that frequently mouse PIP5K1B is named Phosphatidylinositol 4-phosphate 5-kinase type I alpha.Curated

Catalytic activityi

ATP + 1-phosphatidyl-1D-myo-inositol 4-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS02982-MONOMER
ReactomeiR-HSA-1660499 Synthesis of PIPs at the plasma membrane
R-HSA-201688 WNT mediated activation of DVL
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
SABIO-RKiO14986
SIGNORiO14986

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatidylinositol 4-phosphate 5-kinase type-1 beta (EC:2.7.1.68)
Short name:
PIP5K1-beta
Short name:
PtdIns(4)P-5-kinase 1 beta
Alternative name(s):
Phosphatidylinositol 4-phosphate 5-kinase type I beta
Short name:
PIP5KIbeta
Protein STM-7
Type I phosphatidylinositol 4-phosphate 5-kinase beta
Gene namesi
Name:PIP5K1B
Synonyms:STM7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000107242.17
HGNCiHGNC:8995 PIP5K1B
MIMi602745 gene
neXtProtiNX_O14986

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi8395
OpenTargetsiENSG00000107242
PharmGKBiPA33328

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001854581 – 540Phosphatidylinositol 4-phosphate 5-kinase type-1 betaAdd BLAST540

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei445PhosphoserineBy similarity1
Modified residuei447PhosphoserineBy similarity1
Modified residuei448PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO14986
MaxQBiO14986
PaxDbiO14986
PeptideAtlasiO14986
PRIDEiO14986
ProteomicsDBi48360
48361 [O14986-2]

PTM databases

iPTMnetiO14986
PhosphoSitePlusiO14986
SwissPalmiO14986

Expressioni

Tissue specificityi

Detected in heart, pancreas, brain, kidney, skeletal muscle and lung.1 Publication

Gene expression databases

BgeeiENSG00000107242 Expressed in 195 organ(s), highest expression level in choroid plexus epithelium
ExpressionAtlasiO14986 baseline and differential
GenevisibleiO14986 HS

Organism-specific databases

HPAiHPA009687

Interactioni

Subunit structurei

Interacts with RAC1, AJUBA, PLD1, PLD2 and ARF1.By similarity

Protein-protein interaction databases

BioGridi113984, 2 interactors
CORUMiO14986
STRINGi9606.ENSP00000265382

Structurei

3D structure databases

ProteinModelPortaliO14986
SMRiO14986
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 395PIPKPROSITE-ProRule annotationAdd BLAST371

Phylogenomic databases

eggNOGiKOG0229 Eukaryota
COG5253 LUCA
GeneTreeiENSGT00760000119184
HOVERGENiHBG052818
InParanoidiO14986
KOiK00889
OMAiKMHFTYD
OrthoDBiEOG091G0A6L
PhylomeDBiO14986
TreeFamiTF319618

Family and domain databases

Gene3Di3.30.800.10, 1 hit
3.30.810.10, 2 hits
InterProiView protein in InterPro
IPR023610 PInositol-4-P-5-kinase
IPR027483 PInositol-4-P-5-kinase_C
IPR002498 PInositol-4-P-5-kinase_core
IPR027484 PInositol-4-P-5-kinase_N
PANTHERiPTHR23086 PTHR23086, 1 hit
PfamiView protein in Pfam
PF01504 PIP5K, 1 hit
SMARTiView protein in SMART
SM00330 PIPKc, 1 hit
PROSITEiView protein in PROSITE
PS51455 PIPK, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O14986-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSAAENGEA APGKQNEEKT YKKTASSAIK GAIQLGIGYT VGNLTSKPER
60 70 80 90 100
DVLMQDFYVV ESVFLPSEGS NLTPAHHYPD FRFKTYAPLA FRYFRELFGI
110 120 130 140 150
KPDDYLYSIC SEPLIELSNP GASGSLFFVT SDDEFIIKTV QHKEAEFLQK
160 170 180 190 200
LLPGYYMNLN QNPRTLLPKF YGLYCMQSGG INIRIVVMNN VLPRSMRMHF
210 220 230 240 250
TYDLKGSTYK RRASRKEREK SNPTFKDLDF LQDMHEGLYF DTETYNALMK
260 270 280 290 300
TLQRDCRVLE SFKIMDYSLL LGIHFLDHSL KEKEEETPQN VPDAKRTGMQ
310 320 330 340 350
KVLYSTAMES IQGPGKSGDG IITENPDTMG GIPAKSHRGE KLLLFMGIID
360 370 380 390 400
ILQSYRLMKK LEHSWKALVY DGDTVSVHRP SFYADRFLKF MNSRVFKKIQ
410 420 430 440 450
ALKASPSKKR CNSIAALKAT SQEIVSSISQ EWKDEKRDLL TEGQSFSSLD
460 470 480 490 500
EEALGSRHRP DLVPSTPSLF EAASLATTIS SSSLYVNEHY PHDRPTLYSN
510 520 530 540
SKGLPSSSTF TLEEGTIYLT AEPNTLEVQD DNASVLDVYL
Length:540
Mass (Da):61,036
Last modified:October 25, 2005 - v2
Checksum:i7A683794A39A20B6
GO
Isoform 2 (identifier: O14986-2) [UniParc]FASTAAdd to basket
Also known as: Isoform 1

The sequence of this isoform differs from the canonical sequence as follows:
     24-24: T → TQVKNQILSRLPKIPCTFIQAWTNTEMITLLACYYFRSVST
     501-540: SKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL → RFKMATSEH

Show »
Length:549
Mass (Da):62,485
Checksum:iB12247947FAAB6B1
GO
Isoform 3 (identifier: O14986-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     503-540: Missing.

Note: No experimental confirmation available.
Show »
Length:502
Mass (Da):56,951
Checksum:iCC7A35788CB772F2
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MSP5A0A0A0MSP5_HUMAN
Phosphatidylinositol 4-phosphate 5-...
PIP5K1B
162Annotation score:
A0A0A0MT25A0A0A0MT25_HUMAN
Phosphatidylinositol 4-phosphate 5-...
PIP5K1B
157Annotation score:
A0A0A0MRU3A0A0A0MRU3_HUMAN
Phosphatidylinositol 4-phosphate 5-...
PIP5K1B
103Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti346M → T in AAH30587 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_023712415A → T1 PublicationCorresponds to variant dbSNP:rs55897616Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01601024T → TQVKNQILSRLPKIPCTFIQ AWTNTEMITLLACYYFRSVS T in isoform 2. 1 Publication1
Alternative sequenceiVSP_016011501 – 540SKGLP…LDVYL → RFKMATSEH in isoform 2. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_054771503 – 540Missing in isoform 3. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X92493 mRNA Translation: CAA63224.1
U52387
, U52376, U52377, U52378, U52379, U52380, U52381, U52382, U52383, U52384, U52385, U52386 Genomic DNA Translation: AAC51327.1
AK292734 mRNA Translation: BAF85423.1
AK295587 mRNA Translation: BAG58479.1
AL162730 Genomic DNA No translation available.
AL354794 Genomic DNA No translation available.
AL356219 Genomic DNA No translation available.
CH471089 Genomic DNA Translation: EAW62465.1
BC030587 mRNA Translation: AAH30587.1
U78580 mRNA Translation: AAC50915.1
CCDSiCCDS65063.1 [O14986-3]
CCDS6624.1 [O14986-1]
RefSeqiNP_001265182.1, NM_001278253.1 [O14986-3]
NP_003549.1, NM_003558.3 [O14986-1]
XP_005252318.1, XM_005252261.3 [O14986-1]
XP_005252319.1, XM_005252262.4 [O14986-1]
XP_006717363.1, XM_006717300.2 [O14986-1]
XP_006717364.1, XM_006717301.1 [O14986-3]
XP_011517384.1, XM_011519082.2 [O14986-1]
XP_011517385.1, XM_011519083.2 [O14986-1]
XP_011517386.1, XM_011519084.2 [O14986-1]
XP_016870677.1, XM_017015188.1 [O14986-1]
XP_016870678.1, XM_017015189.1 [O14986-1]
XP_016870679.1, XM_017015190.1 [O14986-1]
XP_016870680.1, XM_017015191.1 [O14986-3]
UniGeneiHs.534371

Genome annotation databases

EnsembliENST00000265382; ENSP00000265382; ENSG00000107242 [O14986-1]
ENST00000478500; ENSP00000435778; ENSG00000107242 [O14986-2]
ENST00000541509; ENSP00000438082; ENSG00000107242 [O14986-3]
GeneIDi8395
KEGGihsa:8395
UCSCiuc004agu.5 human [O14986-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X92493 mRNA Translation: CAA63224.1
U52387
, U52376, U52377, U52378, U52379, U52380, U52381, U52382, U52383, U52384, U52385, U52386 Genomic DNA Translation: AAC51327.1
AK292734 mRNA Translation: BAF85423.1
AK295587 mRNA Translation: BAG58479.1
AL162730 Genomic DNA No translation available.
AL354794 Genomic DNA No translation available.
AL356219 Genomic DNA No translation available.
CH471089 Genomic DNA Translation: EAW62465.1
BC030587 mRNA Translation: AAH30587.1
U78580 mRNA Translation: AAC50915.1
CCDSiCCDS65063.1 [O14986-3]
CCDS6624.1 [O14986-1]
RefSeqiNP_001265182.1, NM_001278253.1 [O14986-3]
NP_003549.1, NM_003558.3 [O14986-1]
XP_005252318.1, XM_005252261.3 [O14986-1]
XP_005252319.1, XM_005252262.4 [O14986-1]
XP_006717363.1, XM_006717300.2 [O14986-1]
XP_006717364.1, XM_006717301.1 [O14986-3]
XP_011517384.1, XM_011519082.2 [O14986-1]
XP_011517385.1, XM_011519083.2 [O14986-1]
XP_011517386.1, XM_011519084.2 [O14986-1]
XP_016870677.1, XM_017015188.1 [O14986-1]
XP_016870678.1, XM_017015189.1 [O14986-1]
XP_016870679.1, XM_017015190.1 [O14986-1]
XP_016870680.1, XM_017015191.1 [O14986-3]
UniGeneiHs.534371

3D structure databases

ProteinModelPortaliO14986
SMRiO14986
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113984, 2 interactors
CORUMiO14986
STRINGi9606.ENSP00000265382

PTM databases

iPTMnetiO14986
PhosphoSitePlusiO14986
SwissPalmiO14986

Proteomic databases

EPDiO14986
MaxQBiO14986
PaxDbiO14986
PeptideAtlasiO14986
PRIDEiO14986
ProteomicsDBi48360
48361 [O14986-2]

Protocols and materials databases

DNASUi8395
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265382; ENSP00000265382; ENSG00000107242 [O14986-1]
ENST00000478500; ENSP00000435778; ENSG00000107242 [O14986-2]
ENST00000541509; ENSP00000438082; ENSG00000107242 [O14986-3]
GeneIDi8395
KEGGihsa:8395
UCSCiuc004agu.5 human [O14986-1]

Organism-specific databases

CTDi8395
DisGeNETi8395
EuPathDBiHostDB:ENSG00000107242.17
GeneCardsiPIP5K1B
HGNCiHGNC:8995 PIP5K1B
HPAiHPA009687
MIMi602745 gene
neXtProtiNX_O14986
OpenTargetsiENSG00000107242
PharmGKBiPA33328
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0229 Eukaryota
COG5253 LUCA
GeneTreeiENSGT00760000119184
HOVERGENiHBG052818
InParanoidiO14986
KOiK00889
OMAiKMHFTYD
OrthoDBiEOG091G0A6L
PhylomeDBiO14986
TreeFamiTF319618

Enzyme and pathway databases

BioCyciMetaCyc:HS02982-MONOMER
ReactomeiR-HSA-1660499 Synthesis of PIPs at the plasma membrane
R-HSA-201688 WNT mediated activation of DVL
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
SABIO-RKiO14986
SIGNORiO14986

Miscellaneous databases

ChiTaRSiPIP5K1B human
GeneWikiiPIP5K1B
GenomeRNAii8395
PROiPR:O14986
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000107242 Expressed in 195 organ(s), highest expression level in choroid plexus epithelium
ExpressionAtlasiO14986 baseline and differential
GenevisibleiO14986 HS

Family and domain databases

Gene3Di3.30.800.10, 1 hit
3.30.810.10, 2 hits
InterProiView protein in InterPro
IPR023610 PInositol-4-P-5-kinase
IPR027483 PInositol-4-P-5-kinase_C
IPR002498 PInositol-4-P-5-kinase_core
IPR027484 PInositol-4-P-5-kinase_N
PANTHERiPTHR23086 PTHR23086, 1 hit
PfamiView protein in Pfam
PF01504 PIP5K, 1 hit
SMARTiView protein in SMART
SM00330 PIPKc, 1 hit
PROSITEiView protein in PROSITE
PS51455 PIPK, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPI51B_HUMAN
AccessioniPrimary (citable) accession number: O14986
Secondary accession number(s): A8K9L9
, B4DIG7, P78518, P78519, Q5T5K6, Q5T5K8, Q5T5K9, Q5VZ00, Q7KYT5, Q8NHQ5, Q92749
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: October 25, 2005
Last modified: November 7, 2018
This is version 139 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again