Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Natural cytotoxicity triggering receptor 3

Gene

NCR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG which promote DC maturation.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • identical protein binding Source: IntAct

GO - Biological processi

  • cell recognition Source: BHF-UCL
  • immune response Source: UniProtKB
  • immune response-activating cell surface receptor signaling pathway Source: UniProtKB
  • inflammatory response Source: UniProtKB
  • natural killer cell activation Source: UniProtKB
  • positive regulation of natural killer cell mediated cytotoxicity Source: BHF-UCL
  • regulation of immune response Source: Reactome

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processImmunity

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Natural cytotoxicity triggering receptor 3
Alternative name(s):
Activating natural killer receptor p30
Natural killer cell p30-related protein
Short name:
NK-p30
Short name:
NKp30
CD_antigen: CD337
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NCR3
Synonyms:1C7, LY117
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000204475.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19077 NCR3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611550 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O14931

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini19 – 135ExtracellularSequence analysisAdd BLAST117
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei136 – 156HelicalSequence analysisAdd BLAST21
Topological domaini157 – 201CytoplasmicSequence analysisAdd BLAST45

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
259197

MalaCards human disease database

More...
MalaCardsi
NCR3
MIMi609148 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000204475

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134883693

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NCR3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 18Sequence analysisAdd BLAST18
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001503219 – 201Natural cytotoxicity triggering receptor 3Add BLAST183

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi39 ↔ 108PROSITE-ProRule annotation2 Publications
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi42N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi121N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O14931

PeptideAtlas

More...
PeptideAtlasi
O14931

PRoteomics IDEntifications database

More...
PRIDEi
O14931

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48310
48311 [O14931-2]
48312 [O14931-3]
48313 [O14931-4]
48314 [O14931-5]
48315 [O14931-6]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204475 Expressed in 75 organ(s), highest expression level in leukocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O14931 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O14931 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer in the unliganted form. Interacts with CD3Z. Interacts with and is activated by binding to NCR3LG1. Interacts with and is activated by binding to BAG6.7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
129224, 2 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O14931

Database of interacting proteins

More...
DIPi
DIP-59939N

Protein interaction database and analysis system

More...
IntActi
O14931, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000342156

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1201
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3NOIX-ray1.84A/B18-130[»]
3PV6X-ray2.30B19-135[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O14931

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O14931

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O14931

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini19 – 126Ig-likeAdd BLAST108

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J2FC Eukaryota
ENOG410Z2AU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000006603

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052590

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O14931

KEGG Orthology (KO)

More...
KOi
K06743

Identification of Orthologs from Complete Genome Data

More...
OMAi
RFLCDHQ

Database of Orthologous Groups

More...
OrthoDBi
1270941at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O14931

TreeFam database of animal gene trees

More...
TreeFami
TF337790

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07686 V-set, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409 IG, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835 IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O14931-1) [UniParc]FASTAAdd to basket
Also known as: 1C7a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAWMLLLILI MVHPGSCALW VSQPPEIRTL EGSSAFLPCS FNASQGRLAI
60 70 80 90 100
GSVTWFRDEV VPGKEVRNGT PEFRGRLAPL ASSRFLHDHQ AELHIRDVRG
110 120 130 140 150
HDASIYVCRV EVLGLGVGTG NGTRLVVEKE HPQLGAGTVL LLRAGFYAVS
160 170 180 190 200
FLSVAVGSTV YYQGKCLTWK GPRRQLPAVV PAPLPPPCGS SAHLLPPVPG

G
Length:201
Mass (Da):21,593
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2855AE4D6902D429
GO
Isoform 2 (identifier: O14931-2) [UniParc]FASTAAdd to basket
Also known as: 1C7c

The sequence of this isoform differs from the canonical sequence as follows:
     167-201: LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → HCHMGTHCHSSDGPRGVIPEPRCP

Show »
Length:190
Mass (Da):20,640
Checksum:i1FAC919E20A6B18A
GO
Isoform 3 (identifier: O14931-3) [UniParc]FASTAAdd to basket
Also known as: 1C7b

The sequence of this isoform differs from the canonical sequence as follows:
     166-201: CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → YAKSTLSGFPQL

Show »
Length:177
Mass (Da):19,237
Checksum:iDD5EC96F0AB2DCE6
GO
Isoform 4 (identifier: O14931-4) [UniParc]FASTAAdd to basket
Also known as: 1C7e

The sequence of this isoform differs from the canonical sequence as follows:
     66-90: Missing.

Note: No experimental confirmation available.
Show »
Length:176
Mass (Da):18,749
Checksum:i162BB775DA2BCD35
GO
Isoform 5 (identifier: O14931-5) [UniParc]FASTAAdd to basket
Also known as: 1C7f

The sequence of this isoform differs from the canonical sequence as follows:
     66-90: Missing.
     167-201: LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → HCHMGTHCHSSDGPRGVIPEPRCP

Note: No experimental confirmation available.
Show »
Length:165
Mass (Da):17,796
Checksum:i0A3CA691CA3E1E7E
GO
Isoform 6 (identifier: O14931-6) [UniParc]FASTAAdd to basket
Also known as: 1C7d

The sequence of this isoform differs from the canonical sequence as follows:
     66-90: Missing.
     166-201: CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → YAKSTLSGFPQL

Note: No experimental confirmation available.
Show »
Length:152
Mass (Da):16,393
Checksum:i42718746451F9ADC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JKT7A0A0G2JKT7_HUMAN
Natural cytotoxicity triggering rec...
NCR3
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

A genetic variation in NCR3 is associated with mild malaria susceptibility [MIMi:609148].1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_044114103A → T. Corresponds to variant dbSNP:rs11575840Ensembl.1
Natural variantiVAR_044115174R → S. Corresponds to variant dbSNP:rs3179003Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01041166 – 90Missing in isoform 4, isoform 5 and isoform 6. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_010412166 – 201CLTWK…PVPGG → YAKSTLSGFPQL in isoform 3 and isoform 6. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_010413167 – 201LTWKG…PVPGG → HCHMGTHCHSSDGPRGVIPE PRCP in isoform 2 and isoform 5. 4 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ223153 mRNA Translation: CAB54004.1
AB055881 mRNA Translation: BAB78472.1
Y14768 Genomic DNA Translation: CAA75063.1
Y14768 Genomic DNA Translation: CAA75064.1
Y14768 Genomic DNA Translation: CAA75065.1
Y14768 Genomic DNA Translation: CAA75066.1
Y14768 Genomic DNA Translation: CAA75067.1
Y14768 Genomic DNA Translation: CAA75068.1
AF031136 mRNA Translation: AAB86578.1
AF031137 mRNA Translation: AAB86579.1
AF031138 mRNA Translation: AAB86580.1
AF129756 Genomic DNA Translation: AAD18088.1
BA000025 Genomic DNA Translation: BAB63393.1
AL662801 Genomic DNA No translation available.
AL662847 Genomic DNA No translation available.
AL929587 Genomic DNA No translation available.
BX248519 Genomic DNA No translation available.
BX927320 Genomic DNA No translation available.
CR753892 Genomic DNA No translation available.
CR759886 Genomic DNA No translation available.
CR759905 Genomic DNA No translation available.
CR942185 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03439.1
CH471081 Genomic DNA Translation: EAX03440.1
BC052582 mRNA Translation: AAH52582.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34397.1 [O14931-1]
CCDS47401.1 [O14931-3]
CCDS47402.1 [O14931-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001138938.1, NM_001145466.1 [O14931-3]
NP_001138939.1, NM_001145467.1 [O14931-2]
NP_667341.1, NM_147130.2 [O14931-1]
XP_006715112.1, XM_006715049.3 [O14931-1]
XP_011512761.1, XM_011514459.2 [O14931-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.509513

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000340027; ENSP00000342156; ENSG00000204475 [O14931-1]
ENST00000376071; ENSP00000365239; ENSG00000204475 [O14931-5]
ENST00000376072; ENSP00000365240; ENSG00000204475 [O14931-2]
ENST00000376073; ENSP00000365241; ENSG00000204475 [O14931-3]
ENST00000383476; ENSP00000372968; ENSG00000206430 [O14931-2]
ENST00000383477; ENSP00000372969; ENSG00000206430 [O14931-1]
ENST00000383478; ENSP00000372970; ENSG00000206430 [O14931-3]
ENST00000400241; ENSP00000383100; ENSG00000206430 [O14931-5]
ENST00000412603; ENSP00000389419; ENSG00000225211 [O14931-2]
ENST00000415123; ENSP00000416944; ENSG00000237103 [O14931-1]
ENST00000418936; ENSP00000402904; ENSG00000237808 [O14931-2]
ENST00000419086; ENSP00000416105; ENSG00000223833 [O14931-5]
ENST00000419728; ENSP00000406373; ENSG00000236315 [O14931-5]
ENST00000420485; ENSP00000412474; ENSG00000237808 [O14931-5]
ENST00000420556; ENSP00000405306; ENSG00000236315 [O14931-1]
ENST00000430599; ENSP00000416035; ENSG00000236979 [O14931-1]
ENST00000432392; ENSP00000409874; ENSG00000236315 [O14931-3]
ENST00000433654; ENSP00000391177; ENSG00000237808 [O14931-3]
ENST00000435674; ENSP00000390131; ENSG00000225211 [O14931-1]
ENST00000436253; ENSP00000395238; ENSG00000223833 [O14931-3]
ENST00000436623; ENSP00000404747; ENSG00000237103 [O14931-2]
ENST00000437517; ENSP00000398313; ENSG00000223833 [O14931-1]
ENST00000438663; ENSP00000415697; ENSG00000225211 [O14931-5]
ENST00000439584; ENSP00000408960; ENSG00000237103 [O14931-3]
ENST00000441372; ENSP00000399128; ENSG00000236979 [O14931-2]
ENST00000446756; ENSP00000411205; ENSG00000236979 [O14931-3]
ENST00000447248; ENSP00000389071; ENSG00000237808 [O14931-1]
ENST00000452296; ENSP00000403978; ENSG00000223833 [O14931-2]
ENST00000453657; ENSP00000409048; ENSG00000236979 [O14931-5]
ENST00000455448; ENSP00000415456; ENSG00000237103 [O14931-5]
ENST00000455825; ENSP00000389396; ENSG00000225211 [O14931-3]
ENST00000457547; ENSP00000412702; ENSG00000236315 [O14931-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
259197

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:259197

UCSC genome browser

More...
UCSCi
uc003nuv.3 human [O14931-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ223153 mRNA Translation: CAB54004.1
AB055881 mRNA Translation: BAB78472.1
Y14768 Genomic DNA Translation: CAA75063.1
Y14768 Genomic DNA Translation: CAA75064.1
Y14768 Genomic DNA Translation: CAA75065.1
Y14768 Genomic DNA Translation: CAA75066.1
Y14768 Genomic DNA Translation: CAA75067.1
Y14768 Genomic DNA Translation: CAA75068.1
AF031136 mRNA Translation: AAB86578.1
AF031137 mRNA Translation: AAB86579.1
AF031138 mRNA Translation: AAB86580.1
AF129756 Genomic DNA Translation: AAD18088.1
BA000025 Genomic DNA Translation: BAB63393.1
AL662801 Genomic DNA No translation available.
AL662847 Genomic DNA No translation available.
AL929587 Genomic DNA No translation available.
BX248519 Genomic DNA No translation available.
BX927320 Genomic DNA No translation available.
CR753892 Genomic DNA No translation available.
CR759886 Genomic DNA No translation available.
CR759905 Genomic DNA No translation available.
CR942185 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03439.1
CH471081 Genomic DNA Translation: EAX03440.1
BC052582 mRNA Translation: AAH52582.1
CCDSiCCDS34397.1 [O14931-1]
CCDS47401.1 [O14931-3]
CCDS47402.1 [O14931-2]
RefSeqiNP_001138938.1, NM_001145466.1 [O14931-3]
NP_001138939.1, NM_001145467.1 [O14931-2]
NP_667341.1, NM_147130.2 [O14931-1]
XP_006715112.1, XM_006715049.3 [O14931-1]
XP_011512761.1, XM_011514459.2 [O14931-4]
UniGeneiHs.509513

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3NOIX-ray1.84A/B18-130[»]
3PV6X-ray2.30B19-135[»]
ProteinModelPortaliO14931
SMRiO14931
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129224, 2 interactors
CORUMiO14931
DIPiDIP-59939N
IntActiO14931, 7 interactors
STRINGi9606.ENSP00000342156

Polymorphism and mutation databases

BioMutaiNCR3

Proteomic databases

PaxDbiO14931
PeptideAtlasiO14931
PRIDEiO14931
ProteomicsDBi48310
48311 [O14931-2]
48312 [O14931-3]
48313 [O14931-4]
48314 [O14931-5]
48315 [O14931-6]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
259197
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340027; ENSP00000342156; ENSG00000204475 [O14931-1]
ENST00000376071; ENSP00000365239; ENSG00000204475 [O14931-5]
ENST00000376072; ENSP00000365240; ENSG00000204475 [O14931-2]
ENST00000376073; ENSP00000365241; ENSG00000204475 [O14931-3]
ENST00000383476; ENSP00000372968; ENSG00000206430 [O14931-2]
ENST00000383477; ENSP00000372969; ENSG00000206430 [O14931-1]
ENST00000383478; ENSP00000372970; ENSG00000206430 [O14931-3]
ENST00000400241; ENSP00000383100; ENSG00000206430 [O14931-5]
ENST00000412603; ENSP00000389419; ENSG00000225211 [O14931-2]
ENST00000415123; ENSP00000416944; ENSG00000237103 [O14931-1]
ENST00000418936; ENSP00000402904; ENSG00000237808 [O14931-2]
ENST00000419086; ENSP00000416105; ENSG00000223833 [O14931-5]
ENST00000419728; ENSP00000406373; ENSG00000236315 [O14931-5]
ENST00000420485; ENSP00000412474; ENSG00000237808 [O14931-5]
ENST00000420556; ENSP00000405306; ENSG00000236315 [O14931-1]
ENST00000430599; ENSP00000416035; ENSG00000236979 [O14931-1]
ENST00000432392; ENSP00000409874; ENSG00000236315 [O14931-3]
ENST00000433654; ENSP00000391177; ENSG00000237808 [O14931-3]
ENST00000435674; ENSP00000390131; ENSG00000225211 [O14931-1]
ENST00000436253; ENSP00000395238; ENSG00000223833 [O14931-3]
ENST00000436623; ENSP00000404747; ENSG00000237103 [O14931-2]
ENST00000437517; ENSP00000398313; ENSG00000223833 [O14931-1]
ENST00000438663; ENSP00000415697; ENSG00000225211 [O14931-5]
ENST00000439584; ENSP00000408960; ENSG00000237103 [O14931-3]
ENST00000441372; ENSP00000399128; ENSG00000236979 [O14931-2]
ENST00000446756; ENSP00000411205; ENSG00000236979 [O14931-3]
ENST00000447248; ENSP00000389071; ENSG00000237808 [O14931-1]
ENST00000452296; ENSP00000403978; ENSG00000223833 [O14931-2]
ENST00000453657; ENSP00000409048; ENSG00000236979 [O14931-5]
ENST00000455448; ENSP00000415456; ENSG00000237103 [O14931-5]
ENST00000455825; ENSP00000389396; ENSG00000225211 [O14931-3]
ENST00000457547; ENSP00000412702; ENSG00000236315 [O14931-2]
GeneIDi259197
KEGGihsa:259197
UCSCiuc003nuv.3 human [O14931-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
259197
DisGeNETi259197
EuPathDBiHostDB:ENSG00000204475.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NCR3
HGNCiHGNC:19077 NCR3
MalaCardsiNCR3
MIMi609148 phenotype
611550 gene
neXtProtiNX_O14931
OpenTargetsiENSG00000204475
PharmGKBiPA134883693

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410J2FC Eukaryota
ENOG410Z2AU LUCA
GeneTreeiENSGT00390000006603
HOVERGENiHBG052590
InParanoidiO14931
KOiK06743
OMAiRFLCDHQ
OrthoDBi1270941at2759
PhylomeDBiO14931
TreeFamiTF337790

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

EvolutionaryTraceiO14931

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NCR3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
259197

Protein Ontology

More...
PROi
PR:O14931

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000204475 Expressed in 75 organ(s), highest expression level in leukocyte
ExpressionAtlasiO14931 baseline and differential
GenevisibleiO14931 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNCTR3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O14931
Secondary accession number(s): B0S8F2
, B0S8F4, B0S8F5, O14930, O14932, O95667, O95668, O95669, Q5ST89, Q5ST90, Q5ST91, Q5ST92, Q5STA3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: January 1, 1998
Last modified: January 16, 2019
This is version 162 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again