Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Natural cytotoxicity triggering receptor 3

Gene

NCR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG which promote DC maturation.4 Publications

GO - Molecular functioni

  • identical protein binding Source: IntAct

GO - Biological processi

  • cell recognition Source: BHF-UCL
  • immune response Source: UniProtKB
  • immune response-activating cell surface receptor signaling pathway Source: UniProtKB
  • inflammatory response Source: UniProtKB
  • natural killer cell activation Source: UniProtKB
  • positive regulation of natural killer cell mediated cytotoxicity Source: BHF-UCL
  • regulation of immune response Source: Reactome

Keywordsi

Molecular functionReceptor
Biological processImmunity

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Names & Taxonomyi

Protein namesi
Recommended name:
Natural cytotoxicity triggering receptor 3
Alternative name(s):
Activating natural killer receptor p30
Natural killer cell p30-related protein
Short name:
NK-p30
Short name:
NKp30
CD_antigen: CD337
Gene namesi
Name:NCR3
Synonyms:1C7, LY117
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000204475.9
HGNCiHGNC:19077 NCR3
MIMi611550 gene
neXtProtiNX_O14931

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini19 – 135ExtracellularSequence analysisAdd BLAST117
Transmembranei136 – 156HelicalSequence analysisAdd BLAST21
Topological domaini157 – 201CytoplasmicSequence analysisAdd BLAST45

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi259197
MalaCardsiNCR3
MIMi609148 phenotype
OpenTargetsiENSG00000204475
PharmGKBiPA134883693

Polymorphism and mutation databases

BioMutaiNCR3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 18Sequence analysisAdd BLAST18
ChainiPRO_000001503219 – 201Natural cytotoxicity triggering receptor 3Add BLAST183

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi39 ↔ 108PROSITE-ProRule annotation2 Publications
Glycosylationi42N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi121N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO14931
PeptideAtlasiO14931
PRIDEiO14931
ProteomicsDBi48310
48311 [O14931-2]
48312 [O14931-3]
48313 [O14931-4]
48314 [O14931-5]
48315 [O14931-6]

Expressioni

Tissue specificityi

Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.2 Publications

Gene expression databases

BgeeiENSG00000204475 Expressed in 75 organ(s), highest expression level in leukocyte
ExpressionAtlasiO14931 baseline and differential
GenevisibleiO14931 HS

Interactioni

Subunit structurei

Homodimer in the unliganted form. Interacts with CD3Z. Interacts with and is activated by binding to NCR3LG1. Interacts with and is activated by binding to BAG6.7 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi129224, 2 interactors
CORUMiO14931
DIPiDIP-59939N
IntActiO14931, 7 interactors
STRINGi9606.ENSP00000342156

Structurei

Secondary structure

1201
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO14931
SMRiO14931
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO14931

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini19 – 126Ig-likeAdd BLAST108

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J2FC Eukaryota
ENOG410Z2AU LUCA
GeneTreeiENSGT00390000006603
HOVERGENiHBG052590
InParanoidiO14931
KOiK06743
OMAiRFLCDHQ
OrthoDBiEOG09370V7S
PhylomeDBiO14931
TreeFamiTF337790

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O14931-1) [UniParc]FASTAAdd to basket
Also known as: 1C7a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAWMLLLILI MVHPGSCALW VSQPPEIRTL EGSSAFLPCS FNASQGRLAI
60 70 80 90 100
GSVTWFRDEV VPGKEVRNGT PEFRGRLAPL ASSRFLHDHQ AELHIRDVRG
110 120 130 140 150
HDASIYVCRV EVLGLGVGTG NGTRLVVEKE HPQLGAGTVL LLRAGFYAVS
160 170 180 190 200
FLSVAVGSTV YYQGKCLTWK GPRRQLPAVV PAPLPPPCGS SAHLLPPVPG

G
Length:201
Mass (Da):21,593
Last modified:January 1, 1998 - v1
Checksum:i2855AE4D6902D429
GO
Isoform 2 (identifier: O14931-2) [UniParc]FASTAAdd to basket
Also known as: 1C7c

The sequence of this isoform differs from the canonical sequence as follows:
     167-201: LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → HCHMGTHCHSSDGPRGVIPEPRCP

Show »
Length:190
Mass (Da):20,640
Checksum:i1FAC919E20A6B18A
GO
Isoform 3 (identifier: O14931-3) [UniParc]FASTAAdd to basket
Also known as: 1C7b

The sequence of this isoform differs from the canonical sequence as follows:
     166-201: CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → YAKSTLSGFPQL

Show »
Length:177
Mass (Da):19,237
Checksum:iDD5EC96F0AB2DCE6
GO
Isoform 4 (identifier: O14931-4) [UniParc]FASTAAdd to basket
Also known as: 1C7e

The sequence of this isoform differs from the canonical sequence as follows:
     66-90: Missing.

Note: No experimental confirmation available.
Show »
Length:176
Mass (Da):18,749
Checksum:i162BB775DA2BCD35
GO
Isoform 5 (identifier: O14931-5) [UniParc]FASTAAdd to basket
Also known as: 1C7f

The sequence of this isoform differs from the canonical sequence as follows:
     66-90: Missing.
     167-201: LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → HCHMGTHCHSSDGPRGVIPEPRCP

Note: No experimental confirmation available.
Show »
Length:165
Mass (Da):17,796
Checksum:i0A3CA691CA3E1E7E
GO
Isoform 6 (identifier: O14931-6) [UniParc]FASTAAdd to basket
Also known as: 1C7d

The sequence of this isoform differs from the canonical sequence as follows:
     66-90: Missing.
     166-201: CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → YAKSTLSGFPQL

Note: No experimental confirmation available.
Show »
Length:152
Mass (Da):16,393
Checksum:i42718746451F9ADC
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JKT7A0A0G2JKT7_HUMAN
Natural cytotoxicity triggering rec...
NCR3
115Annotation score:

Polymorphismi

A genetic variation in NCR3 is associated with mild malaria susceptibility [MIMi:609148].1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_044114103A → T. Corresponds to variant dbSNP:rs11575840Ensembl.1
Natural variantiVAR_044115174R → S. Corresponds to variant dbSNP:rs3179003Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01041166 – 90Missing in isoform 4, isoform 5 and isoform 6. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_010412166 – 201CLTWK…PVPGG → YAKSTLSGFPQL in isoform 3 and isoform 6. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_010413167 – 201LTWKG…PVPGG → HCHMGTHCHSSDGPRGVIPE PRCP in isoform 2 and isoform 5. 4 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ223153 mRNA Translation: CAB54004.1
AB055881 mRNA Translation: BAB78472.1
Y14768 Genomic DNA Translation: CAA75063.1
Y14768 Genomic DNA Translation: CAA75064.1
Y14768 Genomic DNA Translation: CAA75065.1
Y14768 Genomic DNA Translation: CAA75066.1
Y14768 Genomic DNA Translation: CAA75067.1
Y14768 Genomic DNA Translation: CAA75068.1
AF031136 mRNA Translation: AAB86578.1
AF031137 mRNA Translation: AAB86579.1
AF031138 mRNA Translation: AAB86580.1
AF129756 Genomic DNA Translation: AAD18088.1
BA000025 Genomic DNA Translation: BAB63393.1
AL662801 Genomic DNA No translation available.
AL662847 Genomic DNA No translation available.
AL929587 Genomic DNA No translation available.
BX248519 Genomic DNA No translation available.
BX927320 Genomic DNA No translation available.
CR753892 Genomic DNA No translation available.
CR759886 Genomic DNA No translation available.
CR759905 Genomic DNA No translation available.
CR942185 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03439.1
CH471081 Genomic DNA Translation: EAX03440.1
BC052582 mRNA Translation: AAH52582.1
CCDSiCCDS34397.1 [O14931-1]
CCDS47401.1 [O14931-3]
CCDS47402.1 [O14931-2]
RefSeqiNP_001138938.1, NM_001145466.1 [O14931-3]
NP_001138939.1, NM_001145467.1 [O14931-2]
NP_667341.1, NM_147130.2 [O14931-1]
XP_006715112.1, XM_006715049.3 [O14931-1]
XP_011512761.1, XM_011514459.2 [O14931-4]
UniGeneiHs.509513

Genome annotation databases

EnsembliENST00000340027; ENSP00000342156; ENSG00000204475 [O14931-1]
ENST00000376071; ENSP00000365239; ENSG00000204475 [O14931-5]
ENST00000376072; ENSP00000365240; ENSG00000204475 [O14931-2]
ENST00000376073; ENSP00000365241; ENSG00000204475 [O14931-3]
ENST00000383476; ENSP00000372968; ENSG00000206430 [O14931-2]
ENST00000383477; ENSP00000372969; ENSG00000206430 [O14931-1]
ENST00000383478; ENSP00000372970; ENSG00000206430 [O14931-3]
ENST00000400241; ENSP00000383100; ENSG00000206430 [O14931-5]
ENST00000412603; ENSP00000389419; ENSG00000225211 [O14931-2]
ENST00000415123; ENSP00000416944; ENSG00000237103 [O14931-1]
ENST00000418936; ENSP00000402904; ENSG00000237808 [O14931-2]
ENST00000419086; ENSP00000416105; ENSG00000223833 [O14931-5]
ENST00000419728; ENSP00000406373; ENSG00000236315 [O14931-5]
ENST00000420485; ENSP00000412474; ENSG00000237808 [O14931-5]
ENST00000420556; ENSP00000405306; ENSG00000236315 [O14931-1]
ENST00000430599; ENSP00000416035; ENSG00000236979 [O14931-1]
ENST00000432392; ENSP00000409874; ENSG00000236315 [O14931-3]
ENST00000433654; ENSP00000391177; ENSG00000237808 [O14931-3]
ENST00000435674; ENSP00000390131; ENSG00000225211 [O14931-1]
ENST00000436253; ENSP00000395238; ENSG00000223833 [O14931-3]
ENST00000436623; ENSP00000404747; ENSG00000237103 [O14931-2]
ENST00000437517; ENSP00000398313; ENSG00000223833 [O14931-1]
ENST00000438663; ENSP00000415697; ENSG00000225211 [O14931-5]
ENST00000439584; ENSP00000408960; ENSG00000237103 [O14931-3]
ENST00000441372; ENSP00000399128; ENSG00000236979 [O14931-2]
ENST00000446756; ENSP00000411205; ENSG00000236979 [O14931-3]
ENST00000447248; ENSP00000389071; ENSG00000237808 [O14931-1]
ENST00000452296; ENSP00000403978; ENSG00000223833 [O14931-2]
ENST00000453657; ENSP00000409048; ENSG00000236979 [O14931-5]
ENST00000455448; ENSP00000415456; ENSG00000237103 [O14931-5]
ENST00000455825; ENSP00000389396; ENSG00000225211 [O14931-3]
ENST00000457547; ENSP00000412702; ENSG00000236315 [O14931-2]
GeneIDi259197
KEGGihsa:259197
UCSCiuc003nuv.3 human [O14931-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ223153 mRNA Translation: CAB54004.1
AB055881 mRNA Translation: BAB78472.1
Y14768 Genomic DNA Translation: CAA75063.1
Y14768 Genomic DNA Translation: CAA75064.1
Y14768 Genomic DNA Translation: CAA75065.1
Y14768 Genomic DNA Translation: CAA75066.1
Y14768 Genomic DNA Translation: CAA75067.1
Y14768 Genomic DNA Translation: CAA75068.1
AF031136 mRNA Translation: AAB86578.1
AF031137 mRNA Translation: AAB86579.1
AF031138 mRNA Translation: AAB86580.1
AF129756 Genomic DNA Translation: AAD18088.1
BA000025 Genomic DNA Translation: BAB63393.1
AL662801 Genomic DNA No translation available.
AL662847 Genomic DNA No translation available.
AL929587 Genomic DNA No translation available.
BX248519 Genomic DNA No translation available.
BX927320 Genomic DNA No translation available.
CR753892 Genomic DNA No translation available.
CR759886 Genomic DNA No translation available.
CR759905 Genomic DNA No translation available.
CR942185 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03439.1
CH471081 Genomic DNA Translation: EAX03440.1
BC052582 mRNA Translation: AAH52582.1
CCDSiCCDS34397.1 [O14931-1]
CCDS47401.1 [O14931-3]
CCDS47402.1 [O14931-2]
RefSeqiNP_001138938.1, NM_001145466.1 [O14931-3]
NP_001138939.1, NM_001145467.1 [O14931-2]
NP_667341.1, NM_147130.2 [O14931-1]
XP_006715112.1, XM_006715049.3 [O14931-1]
XP_011512761.1, XM_011514459.2 [O14931-4]
UniGeneiHs.509513

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3NOIX-ray1.84A/B18-130[»]
3PV6X-ray2.30B19-135[»]
ProteinModelPortaliO14931
SMRiO14931
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129224, 2 interactors
CORUMiO14931
DIPiDIP-59939N
IntActiO14931, 7 interactors
STRINGi9606.ENSP00000342156

Polymorphism and mutation databases

BioMutaiNCR3

Proteomic databases

PaxDbiO14931
PeptideAtlasiO14931
PRIDEiO14931
ProteomicsDBi48310
48311 [O14931-2]
48312 [O14931-3]
48313 [O14931-4]
48314 [O14931-5]
48315 [O14931-6]

Protocols and materials databases

DNASUi259197
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340027; ENSP00000342156; ENSG00000204475 [O14931-1]
ENST00000376071; ENSP00000365239; ENSG00000204475 [O14931-5]
ENST00000376072; ENSP00000365240; ENSG00000204475 [O14931-2]
ENST00000376073; ENSP00000365241; ENSG00000204475 [O14931-3]
ENST00000383476; ENSP00000372968; ENSG00000206430 [O14931-2]
ENST00000383477; ENSP00000372969; ENSG00000206430 [O14931-1]
ENST00000383478; ENSP00000372970; ENSG00000206430 [O14931-3]
ENST00000400241; ENSP00000383100; ENSG00000206430 [O14931-5]
ENST00000412603; ENSP00000389419; ENSG00000225211 [O14931-2]
ENST00000415123; ENSP00000416944; ENSG00000237103 [O14931-1]
ENST00000418936; ENSP00000402904; ENSG00000237808 [O14931-2]
ENST00000419086; ENSP00000416105; ENSG00000223833 [O14931-5]
ENST00000419728; ENSP00000406373; ENSG00000236315 [O14931-5]
ENST00000420485; ENSP00000412474; ENSG00000237808 [O14931-5]
ENST00000420556; ENSP00000405306; ENSG00000236315 [O14931-1]
ENST00000430599; ENSP00000416035; ENSG00000236979 [O14931-1]
ENST00000432392; ENSP00000409874; ENSG00000236315 [O14931-3]
ENST00000433654; ENSP00000391177; ENSG00000237808 [O14931-3]
ENST00000435674; ENSP00000390131; ENSG00000225211 [O14931-1]
ENST00000436253; ENSP00000395238; ENSG00000223833 [O14931-3]
ENST00000436623; ENSP00000404747; ENSG00000237103 [O14931-2]
ENST00000437517; ENSP00000398313; ENSG00000223833 [O14931-1]
ENST00000438663; ENSP00000415697; ENSG00000225211 [O14931-5]
ENST00000439584; ENSP00000408960; ENSG00000237103 [O14931-3]
ENST00000441372; ENSP00000399128; ENSG00000236979 [O14931-2]
ENST00000446756; ENSP00000411205; ENSG00000236979 [O14931-3]
ENST00000447248; ENSP00000389071; ENSG00000237808 [O14931-1]
ENST00000452296; ENSP00000403978; ENSG00000223833 [O14931-2]
ENST00000453657; ENSP00000409048; ENSG00000236979 [O14931-5]
ENST00000455448; ENSP00000415456; ENSG00000237103 [O14931-5]
ENST00000455825; ENSP00000389396; ENSG00000225211 [O14931-3]
ENST00000457547; ENSP00000412702; ENSG00000236315 [O14931-2]
GeneIDi259197
KEGGihsa:259197
UCSCiuc003nuv.3 human [O14931-1]

Organism-specific databases

CTDi259197
DisGeNETi259197
EuPathDBiHostDB:ENSG00000204475.9
GeneCardsiNCR3
HGNCiHGNC:19077 NCR3
MalaCardsiNCR3
MIMi609148 phenotype
611550 gene
neXtProtiNX_O14931
OpenTargetsiENSG00000204475
PharmGKBiPA134883693
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J2FC Eukaryota
ENOG410Z2AU LUCA
GeneTreeiENSGT00390000006603
HOVERGENiHBG052590
InParanoidiO14931
KOiK06743
OMAiRFLCDHQ
OrthoDBiEOG09370V7S
PhylomeDBiO14931
TreeFamiTF337790

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

EvolutionaryTraceiO14931
GeneWikiiNCR3
GenomeRNAii259197
PROiPR:O14931
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000204475 Expressed in 75 organ(s), highest expression level in leukocyte
ExpressionAtlasiO14931 baseline and differential
GenevisibleiO14931 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNCTR3_HUMAN
AccessioniPrimary (citable) accession number: O14931
Secondary accession number(s): B0S8F2
, B0S8F4, B0S8F5, O14930, O14932, O95667, O95668, O95669, Q5ST89, Q5ST90, Q5ST91, Q5ST92, Q5STA3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: January 1, 1998
Last modified: November 7, 2018
This is version 161 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  7. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again