Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O14836 (TR13B_HUMAN)

Entry version 173 (02 Dec 2020)
Sequence version 1 (01 Jan 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Tumor necrosis factor receptor superfamily member 13B

Gene

TNFRSF13B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity. Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • signaling receptor activity Source: ProtInc
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O14836

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5669034, TNFs bind their physiological receptors

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O14836

SIGNOR Signaling Network Open Resource

More...SIGNORi		O14836

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 13B
Alternative name(s):
Transmembrane activator and CAML interactor
CD_antigen: CD267
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TNFRSF13B
Synonyms:TACI
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000240505.8

Human Gene Nomenclature Database

More...HGNCi		HGNC:18153, TNFRSF13B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604907, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O14836

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 165ExtracellularSequence analysisAdd BLAST165
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei166 – 186Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
Topological domaini187 – 293CytoplasmicSequence analysisAdd BLAST107

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Immunodeficiency, common variable, 2 (CVID2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_024027104C → R in CVID2 and IGAD2. 1 PublicationCorresponds to variant dbSNP:rs34557412EnsemblClinVar.1
Natural variantiVAR_024028181A → G in CVID2. 1 Publication1
Natural variantiVAR_024029202R → H in CVID2. 1 PublicationCorresponds to variant dbSNP:rs104894649EnsemblClinVar.1
Immunoglobulin A deficiency 2 (IGAD2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionSelective deficiency of immunoglobulin A (IGAD) is the most common form of primary immunodeficiency, with an incidence of approximately 1 in 600 individuals in the western world. Individuals with symptomatic IGAD often have deficiency of IgG subclasses or decreased antibody response to carbohydrate antigens such as pneumococcal polysaccharide vaccine. Individuals with IGAD also suffer from recurrent sinopulmonary and gastrointestinal infections and have an increased incidence of autoimmune disorders and of lymphoid and non-lymphoid malignancies. In vitro studies have suggested that some individuals with IGAD have impaired isotype class switching to IgA and others may have a post-switch defect. IGAD and CVID have been known to coexist in families. Some individuals initially present with IGAD1 and then develop CVID. These observations suggest that some cases of IGAD and CVID may have a common etiology.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024027104C → R in CVID2 and IGAD2. 1 PublicationCorresponds to variant dbSNP:rs34557412EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...DisGeNETi		23495

MalaCards human disease database

More...MalaCardsi		TNFRSF13B
MIMi240500, phenotype
609529, phenotype

Open Targets

More...OpenTargetsi		ENSG00000240505

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		1572, Common variable immunodeficiency
69127, NON RARE IN EUROPE: Immunoglobulin A deficiency

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA38509

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O14836, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TNFRSF13B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000589311 – 293Tumor necrosis factor receptor superfamily member 13BAdd BLAST293

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi34 ↔ 47By similarity
Disulfide bondi50 ↔ 62By similarity
Disulfide bondi54 ↔ 66By similarity
Disulfide bondi71 ↔ 86
Disulfide bondi89 ↔ 100
Disulfide bondi93 ↔ 104
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi128N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O14836

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O14836

PeptideAtlas

More...PeptideAtlasi		O14836

PRoteomics IDEntifications database

More...PRIDEi		O14836

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		48270 [O14836-1]
48271 [O14836-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O14836, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O14836

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O14836

SwissPalm database of S-palmitoylation events

More...SwissPalmi		O14836

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in spleen, thymus, small intestine and peripheral blood leukocytes. Expressed in resting B-cells and activated T-cells, but not in resting T-cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000240505, Expressed in adrenal gland and 144 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O14836, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O14836, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000240505, Tissue enhanced (blood, lymphoid tissue, skeletal muscle)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds TRAF2, TRAF5 and TRAF6. Binds the NH2-terminal domain of CAMLG with its C-terminus.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		117046, 36 interactors

Database of interacting proteins

More...DIPi		DIP-6224N

Protein interaction database and analysis system

More...IntActi		O14836, 35 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000261652

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O14836, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1293
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O14836

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O14836

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati33 – 67TNFR-Cys 1Add BLAST35
Repeati70 – 104TNFR-Cys 2Add BLAST35

Keywords - Domaini

Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502SANG, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000013910

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_086237_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O14836

Identification of Orthologs from Complete Genome Data

More...OMAi		CHCREDP

Database of Orthologous Groups

More...OrthoDBi		702827at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O14836

TreeFam database of animal gene trees

More...TreeFami		TF337993

Family and domain databases

Conserved Domains Database

More...CDDi		cd13415, TNFRSF13B, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR015384, TACI_Cys-rich-dom
IPR022317, TNFR_13B

The PANTHER Classification System

More...PANTHERi		PTHR15511, PTHR15511, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF09305, TACI-CRD2, 2 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01963, TNFACTORR13B

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00652, TNFR_NGFR_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O14836-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGLGRSRRG GRSRVDQEER FPQGLWTGVA MRSCPEEQYW DPLLGTCMSC 
        60         70         80         90        100
KTICNHQSQR TCAAFCRSLS CRKEQGKFYD HLLRDCISCA SICGQHPKQC 
       110        120        130        140        150
AYFCENKLRS PVNLPPELRR QRSGEVENNS DNSGRYQGLE HRGSEASPAL 
       160        170        180        190        200
PGLKLSADQV ALVYSTLGLC LCAVLCCFLV AVACFLKKRG DPCSCQPRSR 
       210        220        230        240        250
PRQSPAKSSQ DHAMEAGSPV STSPEPVETC SFCFPECRAP TQESAVTPGT 
       260        270        280        290 
PDPTCAGRWG CHTRTTVLQP CPHIPDSGLG IVCVPAQEGG PGA
Length:293
Mass (Da):31,816
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i411799F3DE17A5EB
GO
Isoform 2 (identifier: O14836-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-67: FPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCR → W

Show »
Length:247
Mass (Da):26,664
Checksum:i850E1F4C2578E8E6
GO
Isoform 3 (identifier: O14836-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-176: LPGLKLSADQVALVYSTLGLCLCAVLC → PRGCPAPGTRKSFWDKENFQGEGFHLG
     177-293: Missing.

Show »
Length:176
Mass (Da):19,865
Checksum:i4506764708AF788C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ER05E7ER05_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF13B
248Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QR67J3QR67_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF13B
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06475856H → N Found in a renal cell carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_024027104C → R in CVID2 and IGAD2. 1 PublicationCorresponds to variant dbSNP:rs34557412EnsemblClinVar.1
Natural variantiVAR_024028181A → G in CVID2. 1 Publication1
Natural variantiVAR_024029202R → H in CVID2. 1 PublicationCorresponds to variant dbSNP:rs104894649EnsemblClinVar.1
Natural variantiVAR_052353251P → L1 PublicationCorresponds to variant dbSNP:rs34562254EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01379821 – 67FPQGL…AAFCR → W in isoform 2. 2 PublicationsAdd BLAST47
Alternative sequenceiVSP_054184150 – 176LPGLK…CAVLC → PRGCPAPGTRKSFWDKENFQ GEGFHLG in isoform 3. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_054185177 – 293Missing in isoform 3. 1 PublicationAdd BLAST117

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF023614 mRNA Translation: AAC51790.1
AY302137 mRNA Translation: AAP57629.1
AK301032 mRNA Translation: BAH13394.1
AK313302 mRNA Translation: BAG36107.1
CH471196 Genomic DNA Translation: EAW55729.1
BC109392 mRNA Translation: AAI09393.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11181.1 [O14836-1]

NCBI Reference Sequences

More...RefSeqi		NP_036584.1, NM_012452.2 [O14836-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000261652; ENSP00000261652; ENSG00000240505 [O14836-1]
ENST00000583789; ENSP00000462952; ENSG00000240505 [O14836-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		23495

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:23495

UCSC genome browser

More...UCSCi		uc002gqt.2, human [O14836-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

TNFRSF13Bbase

TNFRSF13B mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF023614 mRNA Translation: AAC51790.1
AY302137 mRNA Translation: AAP57629.1
AK301032 mRNA Translation: BAH13394.1
AK313302 mRNA Translation: BAG36107.1
CH471196 Genomic DNA Translation: EAW55729.1
BC109392 mRNA Translation: AAI09393.1
CCDSiCCDS11181.1 [O14836-1]
RefSeqiNP_036584.1, NM_012452.2 [O14836-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XU1X-ray1.90R/S/T68-109[»]
1XUTNMR-A68-109[»]
SMRiO14836
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi117046, 36 interactors
DIPiDIP-6224N
IntActiO14836, 35 interactors
STRINGi9606.ENSP00000261652

PTM databases

GlyGeniO14836, 1 site
iPTMnetiO14836
PhosphoSitePlusiO14836
SwissPalmiO14836

Polymorphism and mutation databases

BioMutaiTNFRSF13B

Proteomic databases

MassIVEiO14836
PaxDbiO14836
PeptideAtlasiO14836
PRIDEiO14836
ProteomicsDBi48270 [O14836-1]
48271 [O14836-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		35076, 622 antibodies

Genome annotation databases

EnsembliENST00000261652; ENSP00000261652; ENSG00000240505 [O14836-1]
ENST00000583789; ENSP00000462952; ENSG00000240505 [O14836-2]
GeneIDi23495
KEGGihsa:23495
UCSCiuc002gqt.2, human [O14836-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23495
DisGeNETi23495
EuPathDBiHostDB:ENSG00000240505.8

GeneCards: human genes, protein and diseases

More...GeneCardsi		TNFRSF13B
HGNCiHGNC:18153, TNFRSF13B
HPAiENSG00000240505, Tissue enhanced (blood, lymphoid tissue, skeletal muscle)
MalaCardsiTNFRSF13B
MIMi240500, phenotype
604907, gene
609529, phenotype
neXtProtiNX_O14836
OpenTargetsiENSG00000240505
Orphaneti1572, Common variable immunodeficiency
69127, NON RARE IN EUROPE: Immunoglobulin A deficiency
PharmGKBiPA38509

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502SANG, Eukaryota
GeneTreeiENSGT00390000013910
HOGENOMiCLU_086237_0_0_1
InParanoidiO14836
OMAiCHCREDP
OrthoDBi702827at2759
PhylomeDBiO14836
TreeFamiTF337993

Enzyme and pathway databases

PathwayCommonsiO14836
ReactomeiR-HSA-5669034, TNFs bind their physiological receptors
SignaLinkiO14836
SIGNORiO14836

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		23495, 6 hits in 841 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TNFRSF13B, human
EvolutionaryTraceiO14836

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TNFRSF13B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		23495
PharosiO14836, Tbio

Protein Ontology

More...PROi		PR:O14836
RNActiO14836, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000240505, Expressed in adrenal gland and 144 other tissues
ExpressionAtlasiO14836, baseline and differential
GenevisibleiO14836, HS

Family and domain databases

CDDicd13415, TNFRSF13B, 1 hit
InterProiView protein in InterPro
IPR015384, TACI_Cys-rich-dom
IPR022317, TNFR_13B
PANTHERiPTHR15511, PTHR15511, 1 hit
PfamiView protein in Pfam
PF09305, TACI-CRD2, 2 hits
PRINTSiPR01963, TNFACTORR13B
PROSITEiView protein in PROSITE
PS00652, TNFR_NGFR_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTR13B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O14836
Secondary accession number(s): B2R8B0
, B7Z6V8, Q32LX4, Q7Z6F5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 27, 2002
Last sequence update: January 1, 1998
Last modified: December 2, 2020
This is version 173 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again