UniProtKB - O14792 (HS3S1_HUMAN)

BLAST

>sp|O14792|HS3S1_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=HS3ST1 PE=1 SV=1
MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIII
GVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKT
PAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVR
DGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQ
INASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
GRTFDWH

Align
Format
Add to basket Added to basket
History
Entry version 143 (07 Nov 2018)
Sequence version 1 (01 Jan 1998)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Heparan sulfate glucosamine 3-O-sulfotransferase 1

Gene

HS3ST1

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to position 3 of glucosamine residues in heparan. Catalyzes the rate limiting step in the biosynthesis of heparan sulfate (HSact). This modification is a crucial step in the biosynthesis of anticoagulant heparan sulfate as it completes the structure of the antithrombin pentasaccharide binding site.1 Publication

Catalytic activityⁱ

3'-phosphoadenylyl sulfate + [heparan sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan sulfate]-glucosamine 3-sulfate.

Sites

Feature key	Position(s)	DescriptionActions	Length
Binding siteⁱ	147	PAPS	1
Binding siteⁱ	155	PAPS	1
Binding siteⁱ	255	PAPS	1

Regions

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Nucleotide bindingⁱ	64 – 68	PAPS		5
Nucleotide bindingⁱ	270 – 274	PAPS		5

GO - Molecular functionⁱ

[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity Source: Reactome
sulfotransferase activity
Source: ProtInc
Traceable author statementⁱ
- 9988767

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

glycosaminoglycan biosynthetic process Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Transferase

Molecular function

Transferase

Enzyme and pathway databases

BioCycⁱ	MetaCyc:HS00082-MONOMER
Reactomeⁱ	R-HSA-2022928 HS-GAG biosynthesis

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Heparan sulfate glucosamine 3-O-sulfotransferase 1 (EC:2.8.2.23) Alternative name(s): Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1 Short name: 3-OST-1 Short name: Heparan sulfate 3-O-sulfotransferase 1 Short name: h3-OST-1
Gene namesⁱ	Name:HS3ST1 Synonyms:3OST, 3OST1
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 4

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000002587.9
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:5194 HS3ST1
MIMⁱ	603244 gene
neXtProtⁱ	NX_O14792

Keywords - Cellular componentⁱ

Golgi apparatus

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	9957
Open Targets More...OpenTargetsⁱ	ENSG00000002587
PharmGKBⁱ	PA29467

Chemistry databases

Drug and drug target database More...DrugBankⁱ	DB01812 Adenosine-3'-5'-Diphosphate

DrugBankⁱ

DB01812 Adenosine-3'-5'-Diphosphate

Polymorphism and mutation databases

BioMutaⁱ	HS3ST1

BioMutaⁱ

HS3ST1

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 20	By similarityAdd BLAST		20
ChainⁱPRO_0000033451	21 – 307	Heparan sulfate glucosamine 3-O-sulfotransferase 1Add BLAST		287

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Glycosylationⁱ	48	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	192	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	242	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	249	N-linked (GlcNAc...) asparagineSequence analysis	1
Disulfide bondⁱ	256 ↔ 265	1 Publication

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

EPDⁱ	O14792
PaxDbⁱ	O14792
PeptideAtlas More...PeptideAtlasⁱ	O14792
PRIDEⁱ	O14792
ProteomicsDBⁱ	48242

PTM databases

iPTMnetⁱ	O14792
PhosphoSitePlusⁱ	O14792

Expressionⁱ

Tissue specificityⁱ

Highly expressed in the brain and kidney and weakly expressed in the heart, lung and placenta.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000002587 Expressed in 190 organ(s), highest expression level in female gonad
CleanExⁱ	HS_HS3ST1
ExpressionAtlasⁱ	O14792 baseline and differential
Genevisibleⁱ	O14792 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA002237

HPAⁱ

HPA002237

Interactionⁱ

Protein-protein interaction databases

BioGridⁱ	115282, 2 interactors
STRINGⁱ	9606.ENSP00000002596

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	56 – 59	Combined sources	4
Helixⁱ	67 – 74	Combined sources	8
Beta strandⁱ	80 – 82	Combined sources	3
Turnⁱ	89 – 91	Combined sources	3
Helixⁱ	93 – 96	Combined sources	4
Helixⁱ	99 – 105	Combined sources	7
Beta strandⁱ	114 – 119	Combined sources	6
Helixⁱ	121 – 125	Combined sources	5
Helixⁱ	129 – 136	Combined sources	8
Beta strandⁱ	141 – 146	Combined sources	6
Helixⁱ	149 – 166	Combined sources	18
Helixⁱ	174 – 178	Combined sources	5
Helixⁱ	189 – 194	Combined sources	6
Helixⁱ	196 – 204	Combined sources	9
Helixⁱ	209 – 211	Combined sources	3
Beta strandⁱ	212 – 216	Combined sources	5
Helixⁱ	217 – 222	Combined sources	6
Helixⁱ	224 – 234	Combined sources	11
Helixⁱ	243 – 245	Combined sources	3
Beta strandⁱ	246 – 249	Combined sources	4
Turnⁱ	250 – 253	Combined sources	4
Beta strandⁱ	254 – 259	Combined sources	6
Beta strandⁱ	262 – 264	Combined sources	3
Helixⁱ	279 – 288	Combined sources	10
Helixⁱ	290 – 300	Combined sources	11

Show more details

3D structure databases

ProteinModelPortalⁱ	O14792
SMRⁱ	O14792
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	O14792

EvolutionaryTraceⁱ

O14792

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the sulfotransferase 1 family.Curated

Keywords - Domainⁱ

Signal

Phylogenomic databases

eggNOGⁱ	KOG3704 Eukaryota ENOG410XS59 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00760000119023
HOGENOMⁱ	HOG000036663
HOVERGENⁱ	HBG053377
InParanoidⁱ	O14792
KEGG Orthology (KO) More...KOⁱ	K01024
OMAⁱ	RVHSMNP
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0CS5
PhylomeDBⁱ	O14792
TreeFamⁱ	TF350755

Family and domain databases

InterProⁱ	View protein in InterPro IPR037359 NST/OST IPR027417 P-loop_NTPase IPR000863 Sulfotransferase_dom
PANTHERⁱ	PTHR10605 PTHR10605, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00685 Sulfotransfer_1, 1 hit
SUPFAMⁱ	SSF52540 SSF52540, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 1 potential isoform that is computationally mapped.Show all Align All

O14792-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MAALLLGAVL LVAQPQLVPS RPAELGQQEL LRKAGTLQDD VRDGVAPNGS 
        60         70         80         90        100
AQQLPQTIII GVRKGGTRAL LEMLSLHPDV AAAENEVHFF DWEEHYSHGL 
       110        120        130        140        150
GWYLSQMPFS WPHQLTVEKT PAYFTSPKVP ERVYSMNPSI RLLLILRDPS 
       160        170        180        190        200
ERVLSDYTQV FYNHMQKHKP YPSIEEFLVR DGRLNVDYKA LNRSLYHVHM 
       210        220        230        240        250
QNWLRFFPLR HIHIVDGDRL IRDPFPEIQK VERFLKLSPQ INASNFYFNK 
       260        270        280        290        300
TKGFYCLRDS GRDRCLHESK GRAHPQVDPK LLNKLHEYFH EPNKKFFELV 

GRTFDWH

Length:307

Mass (Da):35,773

Last modified:January 1, 1998 - v1

Checksum:ⁱAA1052260633EA1C

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	E9PDE3	E9PDE3_HUMAN		Heparan sulfate glucosamine 3-O-sul... Heparan sulfate glucosamine 3-O-sulfotransferase 1	HS3ST1	82	Annotation score:

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_021515	22	P → T1 PublicationCorresponds to variant dbSNP:rs11559238Ensembl.		1
Natural variantⁱVAR_052529	295	K → R. Corresponds to variant dbSNP:rs34719057Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF019386 mRNA Translation: AAB84388.1 AK096823 mRNA Translation: BAG53368.1 CH471069 Genomic DNA Translation: EAW92699.1 BC057803 mRNA Translation: AAH57803.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS3408.1
NCBI Reference Sequences More...RefSeqⁱ	NP_005105.1, NM_005114.2 XP_011512215.1, XM_011513913.2
UniGeneⁱ	Hs.507348 Hs.605349

Genome annotation databases

Ensemblⁱ	ENST00000002596; ENSP00000002596; ENSG00000002587
GeneIDⁱ	9957
KEGGⁱ	hsa:9957
UCSC genome browser More...UCSCⁱ	uc003gmq.4 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O14792	Sulfotransferase		HUMAN		307	UniRef100_O14792
HS3ST1 isoform 2 (Fragment)		PANTR		83
Heparan sulfate glucosamine 3-O-sulfotransferase 1 (Fragment)		HUMAN		82
HS3ST1 protein (Fragment)		HUMAN		80

Protein	Similar proteins		Species	Score	Length	Source
O14792	Heparan sulfate glucosamine 3-O-sulfotransferase 1	)	MOUSE		311	UniRef90_O35310
Heparan sulfate glucosamine 3-O-sulfotransferase 1		RAT		311
Sulfotransferase		MESAU		311
Sulfotransferase		CASFI		311
Sulfotransferase		CRIGR		311
+25

Protein	Similar proteins		Species	Score	Length	Source
O14792	Heparan sulfate glucosamine 3-O-sulfotransferase 1	)	MOUSE		311	UniRef50_O35310
Heparan sulfate glucosamine 3-O-sulfotransferase 1		RAT		311
Sulfotransferase		CASFI		311
Sulfotransferase		MESAU		311
Sulfotransferase		CRIGR		311
+348

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF019386 mRNA Translation: AAB84388.1 AK096823 mRNA Translation: BAG53368.1 CH471069 Genomic DNA Translation: EAW92699.1 BC057803 mRNA Translation: AAH57803.1
CCDSⁱ	CCDS3408.1
RefSeqⁱ	NP_005105.1, NM_005114.2 XP_011512215.1, XM_011513913.2
UniGeneⁱ	Hs.507348 Hs.605349

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1ZRH	X-ray	2.10	A	36-307	[»]
ProteinModelPortalⁱ	O14792
SMRⁱ	O14792
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	115282, 2 interactors
STRINGⁱ	9606.ENSP00000002596

Chemistry databases

DrugBankⁱ	DB01812 Adenosine-3'-5'-Diphosphate

DrugBankⁱ

DB01812 Adenosine-3'-5'-Diphosphate

PTM databases

iPTMnetⁱ	O14792
PhosphoSitePlusⁱ	O14792

Polymorphism and mutation databases

BioMutaⁱ	HS3ST1

BioMutaⁱ

HS3ST1

Proteomic databases

EPDⁱ	O14792
PaxDbⁱ	O14792
PeptideAtlasⁱ	O14792
PRIDEⁱ	O14792
ProteomicsDBⁱ	48242

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	9957
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000002596; ENSP00000002596; ENSG00000002587
GeneIDⁱ	9957
KEGGⁱ	hsa:9957
UCSCⁱ	uc003gmq.4 human

Organism-specific databases

CTDⁱ	9957
DisGeNETⁱ	9957
EuPathDBⁱ	HostDB:ENSG00000002587.9
GeneCardsⁱ	HS3ST1
H-InvDBⁱ	HIX0004096
HGNCⁱ	HGNC:5194 HS3ST1
HPAⁱ	HPA002237
MIMⁱ	603244 gene
neXtProtⁱ	NX_O14792
OpenTargetsⁱ	ENSG00000002587
PharmGKBⁱ	PA29467
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG3704 Eukaryota ENOG410XS59 LUCA
GeneTreeⁱ	ENSGT00760000119023
HOGENOMⁱ	HOG000036663
HOVERGENⁱ	HBG053377
InParanoidⁱ	O14792
KOⁱ	K01024
OMAⁱ	RVHSMNP
OrthoDBⁱ	EOG091G0CS5
PhylomeDBⁱ	O14792
TreeFamⁱ	TF350755

Enzyme and pathway databases

BioCycⁱ	MetaCyc:HS00082-MONOMER
Reactomeⁱ	R-HSA-2022928 HS-GAG biosynthesis

Miscellaneous databases

ChiTaRSⁱ	HS3ST1 human
EvolutionaryTraceⁱ	O14792
GeneWikiⁱ	HS3ST1
GenomeRNAiⁱ	9957
Protein Ontology More...PROⁱ	PR:O14792
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000002587 Expressed in 190 organ(s), highest expression level in female gonad
CleanExⁱ	HS_HS3ST1
ExpressionAtlasⁱ	O14792 baseline and differential
Genevisibleⁱ	O14792 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR037359 NST/OST IPR027417 P-loop_NTPase IPR000863 Sulfotransferase_dom
PANTHERⁱ	PTHR10605 PTHR10605, 1 hit
Pfamⁱ	View protein in Pfam PF00685 Sulfotransfer_1, 1 hit
SUPFAMⁱ	SSF52540 SSF52540, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	HS3S1_HUMAN
Accessionⁱ	O14792Primary (citable) accession number: O14792 Secondary accession number(s): B3KUA6, Q6PEY8
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	March 15, 2005
	Last sequence update:	January 1, 1998
	Last modified:	November 7, 2018
	This is version 143 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 4
Human chromosome 4: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O14792 (HS3S1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Heparan sulfate glucosamine 3-O-sulfotransferase 1

HS3ST1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Golgi apparatus

Golgi apparatus

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ