Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone demethylase UTY

Gene

UTY

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Male-specific histone demethylase that catalyzes trimethylated 'Lys-27' (H3K27me3) demethylation in histone H3. Has relatively low lysine demethylase activity.1 Publication

Cofactori

Protein has several cofactor binding sites:

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi1093Iron1 Publication1
Metal bindingi1095Iron1 Publication1
Metal bindingi1173Iron1 Publication1
Metal bindingi1278Zinc1 Publication1
Metal bindingi1281Zinc1 Publication1
Metal bindingi1305Zinc1 Publication1
Metal bindingi1308Zinc1 Publication1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChromatin regulator, Dioxygenase, Oxidoreductase
LigandIron, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-3214842 HDMs demethylate histones

Names & Taxonomyi

Protein namesi
Recommended name:
Histone demethylase UTY (EC:1.14.11.-)
Alternative name(s):
Ubiquitously-transcribed TPR protein on the Y chromosome
Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein
Gene namesi
Name:UTY
Synonyms:KDM6C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome Y

Organism-specific databases

EuPathDBiHostDB:ENSG00000183878.15
HGNCiHGNC:12638 UTY
MIMi400009 gene
neXtProtiNX_O14607

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1093H → A: Abolishes lysine demethylase activity. 1 Publication1
Mutagenesisi1138S → G: No effect on lysine demethylase activity. 1 Publication1
Mutagenesisi1214P → I: Significantly higher lysine demethylase activity. 1 Publication1

Organism-specific databases

DisGeNETi7404
OpenTargetsiENSG00000183878
PharmGKBiPA37263

Polymorphism and mutation databases

BioMutaiUTY

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001064111 – 1347Histone demethylase UTYAdd BLAST1347

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei887Phosphothreonine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO14607
PaxDbiO14607
PeptideAtlasiO14607
PRIDEiO14607
ProteomicsDBi48111
48112 [O14607-2]
48113 [O14607-3]
TopDownProteomicsiO14607-2 [O14607-2]

PTM databases

iPTMnetiO14607
PhosphoSitePlusiO14607

Expressioni

Gene expression databases

BgeeiENSG00000183878 Expressed in 190 organ(s), highest expression level in corpus callosum
CleanExiHS_UTY
ExpressionAtlasiO14607 baseline and differential
GenevisibleiO14607 HS

Organism-specific databases

HPAiHPA000568
HPA001165

Interactioni

Subunit structurei

Interacts with TLE1 and TLE2.By similarity

Protein-protein interaction databases

BioGridi113247, 6 interactors
DIPiDIP-48650N
IntActiO14607, 2 interactors
STRINGi9606.ENSP00000328939

Structurei

Secondary structure

11347
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO14607
SMRiO14607
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati90 – 123TPR 1Add BLAST34
Repeati127 – 160TPR 2Add BLAST34
Repeati167 – 196TPR 3Add BLAST30
Repeati202 – 235TPR 4Add BLAST34
Repeati247 – 280TPR 5Add BLAST34
Repeati281 – 314TPR 6Add BLAST34
Repeati315 – 348TPR 7Add BLAST34
Repeati349 – 382TPR 8Add BLAST34
Domaini1042 – 1205JmjCPROSITE-ProRule annotationAdd BLAST164

Sequence similaritiesi

Belongs to the UTX family.Curated

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiKOG1124 Eukaryota
KOG1246 Eukaryota
COG0457 LUCA
GeneTreeiENSGT00410000025758
HOGENOMiHOG000220834
HOVERGENiHBG018063
InParanoidiO14607
KOiK11447
PhylomeDBiO14607
TreeFamiTF317405

Family and domain databases

Gene3Di1.25.40.10, 2 hits
InterProiView protein in InterPro
IPR003347 JmjC_dom
IPR029516 KDM6C
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PANTHERiPTHR14017:SF9 PTHR14017:SF9, 2 hits
PfamiView protein in Pfam
PF02373 JmjC, 1 hit
PF13181 TPR_8, 1 hit
SMARTiView protein in SMART
SM00558 JmjC, 1 hit
SM00028 TPR, 7 hits
SUPFAMiSSF48452 SSF48452, 3 hits
PROSITEiView protein in PROSITE
PS51184 JMJC, 1 hit
PS50005 TPR, 7 hits
PS50293 TPR_REGION, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O14607-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKSCAVSLTT AAVAFGDEAK KMAEGKASRE SEEESVSLTV EEREALGGMD
60 70 80 90 100
SRLFGFVRLH EDGARTKTLL GKAVRCYESL ILKAEGKVES DFFCQLGHFN
110 120 130 140 150
LLLEDYSKAL SAYQRYYSLQ ADYWKNAAFL YGLGLVYFYY NAFHWAIKAF
160 170 180 190 200
QDVLYVDPSF CRAKEIHLRL GLMFKVNTDY KSSLKHFQLA LIDCNPCTLS
210 220 230 240 250
NAEIQFHIAH LYETQRKYHS AKEAYEQLLQ TENLPAQVKA TVLQQLGWMH
260 270 280 290 300
HNMDLVGDKA TKESYAIQYL QKSLEADPNS GQSWYFLGRC YSSIGKVQDA
310 320 330 340 350
FISYRQSIDK SEASADTWCS IGVLYQQQNQ PMDALQAYIC AVQLDHGHAA
360 370 380 390 400
AWMDLGTLYE SCNQPQDAIK CYLNAARSKR CSNTSTLAAR IKFLQNGSDN
410 420 430 440 450
WNGGQSLSHH PVQQVYSLCL TPQKLQHLEQ LRANRDNLNP AQKHQLEQLE
460 470 480 490 500
SQFVLMQQMR HKEVAQVRTT GIHNGAITDS SLPTNSVSNR QPHGALTRVS
510 520 530 540 550
SVSQPGVRPA CVEKLLSSGA FSAGCIPCGT SKILGSTDTI LLGSNCIAGS
560 570 580 590 600
ESNGNVPYLQ QNTHTLPHNH TDLNSSTEEP WRKQLSNSAQ GLHKSQSSCL
610 620 630 640 650
SGPNEEQPLF STGSAQYHQA TSTGIKKANE HLTLPSNSVP QGDADSHLSC
660 670 680 690 700
HTATSGGQQG IMFTKESKPS KNRSLVPETS RHTGDTSNGC ADVKGLSNHV
710 720 730 740 750
HQLIADAVSS PNHGDSPNLL IADNPQLSAL LIGKANGNVG TGTCDKVNNI
760 770 780 790 800
HPAVHTKTDH SVASSPSSAI STATPSPKST EQRSINSVTS LNSPHSGLHT
810 820 830 840 850
VNGEGLGKSQ SSTKVDLPLA SHRSTSQILP SMSVSICPSS TEVLKACRNP
860 870 880 890 900
GKNGLSNSCI LLDKCPPPRP PTSPYPPLPK DKLNPPTPSI YLENKRDAFF
910 920 930 940 950
PPLHQFCTNP KNPVTVIRGL AGALKLDLGL FSTKTLVEAN NEHMVEVRTQ
960 970 980 990 1000
LLQPADENWD PTGTKKIWRC ESNRSHTTIA KYAQYQASSF QESLREENEK
1010 1020 1030 1040 1050
RTQHKDHSDN ESTSSENSGR RRKGPFKTIK FGTNIDLSDN KKWKLQLHEL
1060 1070 1080 1090 1100
TKLPAFARVV SAGNLLTHVG HTILGMNTVQ LYMKVPGSRT PGHQENNNFC
1110 1120 1130 1140 1150
SVNINIGPGD CEWFVVPEDY WGVLNDFCEK NNLNFLMSSW WPNLEDLYEA
1160 1170 1180 1190 1200
NVPVYRFIQR PGDLVWINAG TVHWVQAVGW CNNIAWNVGP LTACQYKLAV
1210 1220 1230 1240 1250
ERYEWNKLKS VKSPVPMVHL SWNMARNIKV SDPKLFEMIK YCLLKILKQY
1260 1270 1280 1290 1300
QTLREALVAA GKEVIWHGRT NDEPAHYCSI CEVEVFNLLF VTNESNTQKT
1310 1320 1330 1340
YIVHCHDCAR KTSKSLENFV VLEQYKMEDL IQVYDQFTLA LSLSSSS
Length:1,347
Mass (Da):149,548
Last modified:April 14, 2009 - v2
Checksum:iD83B8CAB861BCE60
GO
Isoform 2 (identifier: O14607-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     996-1079: EENEKRTQHK...GHTILGMNTV → AGMQWCDLSS...GITGVSHHAR
     1080-1347: Missing.

Show »
Length:1,079
Mass (Da):118,074
Checksum:iB48FF0FAFFED5998
GO
Isoform 3 (identifier: O14607-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1241-1347: Missing.

Show »
Length:1,240
Mass (Da):137,213
Checksum:i38B414FFA5AC7C07
GO
Isoform 4 (identifier: O14607-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ

Show »
Length:1,392
Mass (Da):154,437
Checksum:iF49723B217462AD0
GO
Isoform 5 (identifier: O14607-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ
     465-588: Missing.
     1283-1339: Missing.

Show »
Length:1,211
Mass (Da):134,762
Checksum:iC429C9E257FD074A
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X248A0A087X248_HUMAN
Histone demethylase UTY
UTY
1,264Annotation score:
F5H8B4F5H8B4_HUMAN
Histone demethylase UTY
UTY
1,444Annotation score:
A0A087X0Y2A0A087X0Y2_HUMAN
Histone demethylase UTY
UTY
1,399Annotation score:
A0A087X2I9A0A087X2I9_HUMAN
Histone demethylase UTY
UTY
1,367Annotation score:
F5H3N7F5H3N7_HUMAN
Histone demethylase UTY
UTY
1,363Annotation score:
A0A096LPD8A0A096LPD8_HUMAN
Histone demethylase UTY
UTY
1,335Annotation score:
F5GWV3F5GWV3_HUMAN
Histone demethylase UTY
UTY
1,389Annotation score:
A6NCS7A6NCS7_HUMAN
Histone demethylase UTY
UTY
207Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti81I → L in ABA25871 (Ref. 2) Curated1
Sequence conflicti86G → R in ABA25870 (Ref. 2) Curated1
Sequence conflicti122D → G in ABA25870 (Ref. 2) Curated1
Sequence conflicti218Y → C in ABA25871 (Ref. 2) Curated1
Sequence conflicti297V → A in ABA25870 (Ref. 2) Curated1
Sequence conflicti301F → S in BAF85547 (PubMed:14702039).Curated1
Sequence conflicti302I → V in ABA25870 (Ref. 2) Curated1
Sequence conflicti372Y → H in ABA25870 (Ref. 2) Curated1
Sequence conflicti431L → P in ABA25870 (Ref. 2) Curated1
Sequence conflicti625I → T in BAF85547 (PubMed:14702039).Curated1
Sequence conflicti644A → V in ABA25870 (Ref. 2) Curated1
Sequence conflicti793S → R in ABA25871 (Ref. 2) Curated1
Sequence conflicti1177A → T in AAC51841 (PubMed:9381176).Curated1
Sequence conflicti1177A → T in AAC51842 (PubMed:9381176).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045611394L → LQAQLCNLPQSSLQNKTKLL PSIEEAWSLPIPAELTSRQG AMNTAQ in isoform 4 and isoform 5. 1 Publication1
Alternative sequenceiVSP_045612465 – 588Missing in isoform 5. 1 PublicationAdd BLAST124
Alternative sequenceiVSP_006556996 – 1079EENEK…GMNTV → AGMQWCDLSSLQPPPPGFKR FSHLSLPNSWNYRHLPSCPT NFCIFVETGFHHVGQACLEL LTSGGLLASASQSAGITGVS HHAR in isoform 2. 2 PublicationsAdd BLAST84
Alternative sequenceiVSP_0367831080 – 1347Missing in isoform 2. 2 PublicationsAdd BLAST268
Alternative sequenceiVSP_0367841241 – 1347Missing in isoform 3. 1 PublicationAdd BLAST107
Alternative sequenceiVSP_0456131283 – 1339Missing in isoform 5. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000994 mRNA Translation: AAC51841.1
AF000995 mRNA Translation: AAC51842.1
AF000996 mRNA Translation: AAC51843.1
DQ140389 mRNA Translation: ABA25870.1
DQ140390 mRNA Translation: ABA25871.1
AK292858 mRNA Translation: BAF85547.1
AC005820 Genomic DNA No translation available.
AC006376 Genomic DNA No translation available.
AC010877 Genomic DNA No translation available.
CCDSiCCDS14783.1 [O14607-1]
CCDS14784.1 [O14607-3]
CCDS14785.1 [O14607-2]
CCDS59184.1 [O14607-4]
CCDS59185.1 [O14607-5]
PIRiT02214
RefSeqiNP_001245181.1, NM_001258252.1 [O14607-4]
NP_001245183.1, NM_001258254.1 [O14607-5]
NP_009056.3, NM_007125.4 [O14607-1]
NP_872600.1, NM_182659.1 [O14607-3]
NP_872601.1, NM_182660.1 [O14607-2]
UniGeneiHs.115277

Genome annotation databases

EnsembliENST00000329134; ENSP00000330446; ENSG00000183878 [O14607-2]
ENST00000331397; ENSP00000328939; ENSG00000183878 [O14607-1]
ENST00000362096; ENSP00000355420; ENSG00000183878 [O14607-3]
ENST00000382896; ENSP00000372352; ENSG00000183878 [O14607-4]
ENST00000624098; ENSP00000485539; ENSG00000183878 [O14607-5]
GeneIDi7404
KEGGihsa:7404
UCSCiuc004fsx.3 human [O14607-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000994 mRNA Translation: AAC51841.1
AF000995 mRNA Translation: AAC51842.1
AF000996 mRNA Translation: AAC51843.1
DQ140389 mRNA Translation: ABA25870.1
DQ140390 mRNA Translation: ABA25871.1
AK292858 mRNA Translation: BAF85547.1
AC005820 Genomic DNA No translation available.
AC006376 Genomic DNA No translation available.
AC010877 Genomic DNA No translation available.
CCDSiCCDS14783.1 [O14607-1]
CCDS14784.1 [O14607-3]
CCDS14785.1 [O14607-2]
CCDS59184.1 [O14607-4]
CCDS59185.1 [O14607-5]
PIRiT02214
RefSeqiNP_001245181.1, NM_001258252.1 [O14607-4]
NP_001245183.1, NM_001258254.1 [O14607-5]
NP_009056.3, NM_007125.4 [O14607-1]
NP_872600.1, NM_182659.1 [O14607-3]
NP_872601.1, NM_182660.1 [O14607-2]
UniGeneiHs.115277

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3ZLIX-ray1.80A/B878-1347[»]
3ZPOX-ray2.00A/B878-1347[»]
4UF0X-ray1.78A/B878-1347[»]
5A1LX-ray2.00A/B878-1347[»]
5FXVX-ray1.91A/B878-1347[»]
5FXWX-ray2.09A/B878-1347[»]
5FXXX-ray1.99A/B878-1347[»]
5FXZX-ray1.98A/B878-1347[»]
5FY0X-ray2.14A/B878-1347[»]
5FY1X-ray1.78A/B878-1347[»]
5FY7X-ray1.86A/B878-1347[»]
5FYMX-ray2.00A/B878-1347[»]
ProteinModelPortaliO14607
SMRiO14607
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113247, 6 interactors
DIPiDIP-48650N
IntActiO14607, 2 interactors
STRINGi9606.ENSP00000328939

PTM databases

iPTMnetiO14607
PhosphoSitePlusiO14607

Polymorphism and mutation databases

BioMutaiUTY

Proteomic databases

MaxQBiO14607
PaxDbiO14607
PeptideAtlasiO14607
PRIDEiO14607
ProteomicsDBi48111
48112 [O14607-2]
48113 [O14607-3]
TopDownProteomicsiO14607-2 [O14607-2]

Protocols and materials databases

DNASUi7404
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329134; ENSP00000330446; ENSG00000183878 [O14607-2]
ENST00000331397; ENSP00000328939; ENSG00000183878 [O14607-1]
ENST00000362096; ENSP00000355420; ENSG00000183878 [O14607-3]
ENST00000382896; ENSP00000372352; ENSG00000183878 [O14607-4]
ENST00000624098; ENSP00000485539; ENSG00000183878 [O14607-5]
GeneIDi7404
KEGGihsa:7404
UCSCiuc004fsx.3 human [O14607-1]

Organism-specific databases

CTDi7404
DisGeNETi7404
EuPathDBiHostDB:ENSG00000183878.15
GeneCardsiUTY
H-InvDBiHIX0056663
HGNCiHGNC:12638 UTY
HPAiHPA000568
HPA001165
MIMi400009 gene
neXtProtiNX_O14607
OpenTargetsiENSG00000183878
PharmGKBiPA37263
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1124 Eukaryota
KOG1246 Eukaryota
COG0457 LUCA
GeneTreeiENSGT00410000025758
HOGENOMiHOG000220834
HOVERGENiHBG018063
InParanoidiO14607
KOiK11447
PhylomeDBiO14607
TreeFamiTF317405

Enzyme and pathway databases

ReactomeiR-HSA-3214842 HDMs demethylate histones

Miscellaneous databases

ChiTaRSiUTY human
GeneWikiiUTY_(gene)
GenomeRNAii7404
PROiPR:O14607
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000183878 Expressed in 190 organ(s), highest expression level in corpus callosum
CleanExiHS_UTY
ExpressionAtlasiO14607 baseline and differential
GenevisibleiO14607 HS

Family and domain databases

Gene3Di1.25.40.10, 2 hits
InterProiView protein in InterPro
IPR003347 JmjC_dom
IPR029516 KDM6C
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PANTHERiPTHR14017:SF9 PTHR14017:SF9, 2 hits
PfamiView protein in Pfam
PF02373 JmjC, 1 hit
PF13181 TPR_8, 1 hit
SMARTiView protein in SMART
SM00558 JmjC, 1 hit
SM00028 TPR, 7 hits
SUPFAMiSSF48452 SSF48452, 3 hits
PROSITEiView protein in PROSITE
PS51184 JMJC, 1 hit
PS50005 TPR, 7 hits
PS50293 TPR_REGION, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiUTY_HUMAN
AccessioniPrimary (citable) accession number: O14607
Secondary accession number(s): A8K9Z3
, E1U199, E1U1A0, F5H4V7, F8W8R7, O14608
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: April 14, 2009
Last modified: November 7, 2018
This is version 165 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome Y
    Human chromosome Y: entries, gene names and cross-references to MIM
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again