Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 170 (08 May 2019)
Sequence version 2 (14 Apr 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Histone demethylase UTY

Gene

UTY

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Male-specific histone demethylase that catalyzes trimethylated 'Lys-27' (H3K27me3) demethylation in histone H3. Has relatively low lysine demethylase activity.1 Publication

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Protein has several cofactor binding sites:

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi1093Iron1 Publication1
Metal bindingi1095Iron1 Publication1
Metal bindingi1173Iron1 Publication1
Metal bindingi1278Zinc1 Publication1
Metal bindingi1281Zinc1 Publication1
Metal bindingi1305Zinc1 Publication1
Metal bindingi1308Zinc1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, Dioxygenase, Oxidoreductase
LigandIron, Metal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3214842 HDMs demethylate histones

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Histone demethylase UTY (EC:1.14.11.-)
Alternative name(s):
Ubiquitously-transcribed TPR protein on the Y chromosome
Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UTY
Synonyms:KDM6C
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome Y

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12638 UTY

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
400009 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O14607

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1093H → A: Abolishes lysine demethylase activity. 1 Publication1
Mutagenesisi1138S → G: No effect on lysine demethylase activity. 1 Publication1
Mutagenesisi1214P → I: Significantly higher lysine demethylase activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
7404

Open Targets

More...
OpenTargetsi
ENSG00000183878

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37263

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UTY

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001064111 – 1347Histone demethylase UTYAdd BLAST1347

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei887Phosphothreonine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O14607

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O14607

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O14607

PeptideAtlas

More...
PeptideAtlasi
O14607

PRoteomics IDEntifications database

More...
PRIDEi
O14607

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48111
48112 [O14607-2]
48113 [O14607-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
O14607-2 [O14607-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O14607

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O14607

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000183878 Expressed in 190 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O14607 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O14607 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA000568
HPA001165

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TLE1 and TLE2.By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113247, 6 interactors

Database of interacting proteins

More...
DIPi
DIP-48650N

Protein interaction database and analysis system

More...
IntActi
O14607, 3 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11347
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3ZLIX-ray1.80A/B878-1347[»]
3ZPOX-ray2.00A/B878-1347[»]
4UF0X-ray1.78A/B878-1347[»]
5A1LX-ray2.00A/B878-1347[»]
5FXVX-ray1.91A/B878-1347[»]
5FXWX-ray2.09A/B878-1347[»]
5FXXX-ray1.99A/B878-1347[»]
5FXZX-ray1.98A/B878-1347[»]
5FY0X-ray2.14A/B878-1347[»]
5FY1X-ray1.78A/B878-1347[»]
5FY7X-ray1.86A/B878-1347[»]
5FYMX-ray2.00A/B878-1347[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O14607

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati90 – 123TPR 1Add BLAST34
Repeati127 – 160TPR 2Add BLAST34
Repeati167 – 196TPR 3Add BLAST30
Repeati202 – 235TPR 4Add BLAST34
Repeati247 – 280TPR 5Add BLAST34
Repeati281 – 314TPR 6Add BLAST34
Repeati315 – 348TPR 7Add BLAST34
Repeati349 – 382TPR 8Add BLAST34
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1042 – 1205JmjCPROSITE-ProRule annotationAdd BLAST164

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the UTX family.Curated

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1124 Eukaryota
KOG1246 Eukaryota
COG0457 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155202

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000220834

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O14607

KEGG Orthology (KO)

More...
KOi
K11447

Database of Orthologous Groups

More...
OrthoDBi
268901at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O14607

TreeFam database of animal gene trees

More...
TreeFami
TF317405

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003347 JmjC_dom
IPR029516 KDM6C
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat

The PANTHER Classification System

More...
PANTHERi
PTHR14017:SF25 PTHR14017:SF25, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02373 JmjC, 1 hit
PF13181 TPR_8, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00558 JmjC, 1 hit
SM00028 TPR, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48452 SSF48452, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51184 JMJC, 1 hit
PS50005 TPR, 7 hits
PS50293 TPR_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O14607-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKSCAVSLTT AAVAFGDEAK KMAEGKASRE SEEESVSLTV EEREALGGMD
60 70 80 90 100
SRLFGFVRLH EDGARTKTLL GKAVRCYESL ILKAEGKVES DFFCQLGHFN
110 120 130 140 150
LLLEDYSKAL SAYQRYYSLQ ADYWKNAAFL YGLGLVYFYY NAFHWAIKAF
160 170 180 190 200
QDVLYVDPSF CRAKEIHLRL GLMFKVNTDY KSSLKHFQLA LIDCNPCTLS
210 220 230 240 250
NAEIQFHIAH LYETQRKYHS AKEAYEQLLQ TENLPAQVKA TVLQQLGWMH
260 270 280 290 300
HNMDLVGDKA TKESYAIQYL QKSLEADPNS GQSWYFLGRC YSSIGKVQDA
310 320 330 340 350
FISYRQSIDK SEASADTWCS IGVLYQQQNQ PMDALQAYIC AVQLDHGHAA
360 370 380 390 400
AWMDLGTLYE SCNQPQDAIK CYLNAARSKR CSNTSTLAAR IKFLQNGSDN
410 420 430 440 450
WNGGQSLSHH PVQQVYSLCL TPQKLQHLEQ LRANRDNLNP AQKHQLEQLE
460 470 480 490 500
SQFVLMQQMR HKEVAQVRTT GIHNGAITDS SLPTNSVSNR QPHGALTRVS
510 520 530 540 550
SVSQPGVRPA CVEKLLSSGA FSAGCIPCGT SKILGSTDTI LLGSNCIAGS
560 570 580 590 600
ESNGNVPYLQ QNTHTLPHNH TDLNSSTEEP WRKQLSNSAQ GLHKSQSSCL
610 620 630 640 650
SGPNEEQPLF STGSAQYHQA TSTGIKKANE HLTLPSNSVP QGDADSHLSC
660 670 680 690 700
HTATSGGQQG IMFTKESKPS KNRSLVPETS RHTGDTSNGC ADVKGLSNHV
710 720 730 740 750
HQLIADAVSS PNHGDSPNLL IADNPQLSAL LIGKANGNVG TGTCDKVNNI
760 770 780 790 800
HPAVHTKTDH SVASSPSSAI STATPSPKST EQRSINSVTS LNSPHSGLHT
810 820 830 840 850
VNGEGLGKSQ SSTKVDLPLA SHRSTSQILP SMSVSICPSS TEVLKACRNP
860 870 880 890 900
GKNGLSNSCI LLDKCPPPRP PTSPYPPLPK DKLNPPTPSI YLENKRDAFF
910 920 930 940 950
PPLHQFCTNP KNPVTVIRGL AGALKLDLGL FSTKTLVEAN NEHMVEVRTQ
960 970 980 990 1000
LLQPADENWD PTGTKKIWRC ESNRSHTTIA KYAQYQASSF QESLREENEK
1010 1020 1030 1040 1050
RTQHKDHSDN ESTSSENSGR RRKGPFKTIK FGTNIDLSDN KKWKLQLHEL
1060 1070 1080 1090 1100
TKLPAFARVV SAGNLLTHVG HTILGMNTVQ LYMKVPGSRT PGHQENNNFC
1110 1120 1130 1140 1150
SVNINIGPGD CEWFVVPEDY WGVLNDFCEK NNLNFLMSSW WPNLEDLYEA
1160 1170 1180 1190 1200
NVPVYRFIQR PGDLVWINAG TVHWVQAVGW CNNIAWNVGP LTACQYKLAV
1210 1220 1230 1240 1250
ERYEWNKLKS VKSPVPMVHL SWNMARNIKV SDPKLFEMIK YCLLKILKQY
1260 1270 1280 1290 1300
QTLREALVAA GKEVIWHGRT NDEPAHYCSI CEVEVFNLLF VTNESNTQKT
1310 1320 1330 1340
YIVHCHDCAR KTSKSLENFV VLEQYKMEDL IQVYDQFTLA LSLSSSS
Length:1,347
Mass (Da):149,548
Last modified:April 14, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD83B8CAB861BCE60
GO
Isoform 2 (identifier: O14607-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     996-1079: EENEKRTQHK...GHTILGMNTV → AGMQWCDLSS...GITGVSHHAR
     1080-1347: Missing.

Show »
Length:1,079
Mass (Da):118,074
Checksum:iB48FF0FAFFED5998
GO
Isoform 3 (identifier: O14607-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1241-1347: Missing.

Show »
Length:1,240
Mass (Da):137,213
Checksum:i38B414FFA5AC7C07
GO
Isoform 4 (identifier: O14607-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ

Show »
Length:1,392
Mass (Da):154,437
Checksum:iF49723B217462AD0
GO
Isoform 5 (identifier: O14607-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ
     465-588: Missing.
     1283-1339: Missing.

Show »
Length:1,211
Mass (Da):134,762
Checksum:iC429C9E257FD074A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X248A0A087X248_HUMAN
Histone demethylase UTY
UTY
1,264Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H3N7F5H3N7_HUMAN
Histone demethylase UTY
UTY
1,363Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X2I9A0A087X2I9_HUMAN
Histone demethylase UTY
UTY
1,367Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H8B4F5H8B4_HUMAN
Histone demethylase UTY
UTY
1,444Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X0Y2A0A087X0Y2_HUMAN
Histone demethylase UTY
UTY
1,399Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A096LPD8A0A096LPD8_HUMAN
Histone demethylase UTY
UTY
1,335Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GWV3F5GWV3_HUMAN
Histone demethylase UTY
UTY
1,389Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A6NCS7A6NCS7_HUMAN
Histone demethylase UTY
UTY
207Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti81I → L in ABA25871 (Ref. 2) Curated1
Sequence conflicti86G → R in ABA25870 (Ref. 2) Curated1
Sequence conflicti122D → G in ABA25870 (Ref. 2) Curated1
Sequence conflicti218Y → C in ABA25871 (Ref. 2) Curated1
Sequence conflicti297V → A in ABA25870 (Ref. 2) Curated1
Sequence conflicti301F → S in BAF85547 (PubMed:14702039).Curated1
Sequence conflicti302I → V in ABA25870 (Ref. 2) Curated1
Sequence conflicti372Y → H in ABA25870 (Ref. 2) Curated1
Sequence conflicti431L → P in ABA25870 (Ref. 2) Curated1
Sequence conflicti625I → T in BAF85547 (PubMed:14702039).Curated1
Sequence conflicti644A → V in ABA25870 (Ref. 2) Curated1
Sequence conflicti793S → R in ABA25871 (Ref. 2) Curated1
Sequence conflicti1177A → T in AAC51841 (PubMed:9381176).Curated1
Sequence conflicti1177A → T in AAC51842 (PubMed:9381176).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_045611394L → LQAQLCNLPQSSLQNKTKLL PSIEEAWSLPIPAELTSRQG AMNTAQ in isoform 4 and isoform 5. 1 Publication1
Alternative sequenceiVSP_045612465 – 588Missing in isoform 5. 1 PublicationAdd BLAST124
Alternative sequenceiVSP_006556996 – 1079EENEK…GMNTV → AGMQWCDLSSLQPPPPGFKR FSHLSLPNSWNYRHLPSCPT NFCIFVETGFHHVGQACLEL LTSGGLLASASQSAGITGVS HHAR in isoform 2. 2 PublicationsAdd BLAST84
Alternative sequenceiVSP_0367831080 – 1347Missing in isoform 2. 2 PublicationsAdd BLAST268
Alternative sequenceiVSP_0367841241 – 1347Missing in isoform 3. 1 PublicationAdd BLAST107
Alternative sequenceiVSP_0456131283 – 1339Missing in isoform 5. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF000994 mRNA Translation: AAC51841.1
AF000995 mRNA Translation: AAC51842.1
AF000996 mRNA Translation: AAC51843.1
DQ140389 mRNA Translation: ABA25870.1
DQ140390 mRNA Translation: ABA25871.1
AK292858 mRNA Translation: BAF85547.1
AC005820 Genomic DNA No translation available.
AC006376 Genomic DNA No translation available.
AC010877 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14783.1 [O14607-1]
CCDS14784.1 [O14607-3]
CCDS14785.1 [O14607-2]
CCDS59184.1 [O14607-4]
CCDS59185.1 [O14607-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
T02214

NCBI Reference Sequences

More...
RefSeqi
NP_001245181.1, NM_001258252.1 [O14607-4]
NP_001245183.1, NM_001258254.1 [O14607-5]
NP_009056.3, NM_007125.4 [O14607-1]
NP_872600.1, NM_182659.1 [O14607-3]
NP_872601.1, NM_182660.1 [O14607-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000329134; ENSP00000330446; ENSG00000183878 [O14607-2]
ENST00000331397; ENSP00000328939; ENSG00000183878 [O14607-1]
ENST00000362096; ENSP00000355420; ENSG00000183878 [O14607-3]
ENST00000382896; ENSP00000372352; ENSG00000183878 [O14607-4]
ENST00000624098; ENSP00000485539; ENSG00000183878 [O14607-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7404

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7404

UCSC genome browser

More...
UCSCi
uc004fsx.3 human [O14607-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000994 mRNA Translation: AAC51841.1
AF000995 mRNA Translation: AAC51842.1
AF000996 mRNA Translation: AAC51843.1
DQ140389 mRNA Translation: ABA25870.1
DQ140390 mRNA Translation: ABA25871.1
AK292858 mRNA Translation: BAF85547.1
AC005820 Genomic DNA No translation available.
AC006376 Genomic DNA No translation available.
AC010877 Genomic DNA No translation available.
CCDSiCCDS14783.1 [O14607-1]
CCDS14784.1 [O14607-3]
CCDS14785.1 [O14607-2]
CCDS59184.1 [O14607-4]
CCDS59185.1 [O14607-5]
PIRiT02214
RefSeqiNP_001245181.1, NM_001258252.1 [O14607-4]
NP_001245183.1, NM_001258254.1 [O14607-5]
NP_009056.3, NM_007125.4 [O14607-1]
NP_872600.1, NM_182659.1 [O14607-3]
NP_872601.1, NM_182660.1 [O14607-2]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3ZLIX-ray1.80A/B878-1347[»]
3ZPOX-ray2.00A/B878-1347[»]
4UF0X-ray1.78A/B878-1347[»]
5A1LX-ray2.00A/B878-1347[»]
5FXVX-ray1.91A/B878-1347[»]
5FXWX-ray2.09A/B878-1347[»]
5FXXX-ray1.99A/B878-1347[»]
5FXZX-ray1.98A/B878-1347[»]
5FY0X-ray2.14A/B878-1347[»]
5FY1X-ray1.78A/B878-1347[»]
5FY7X-ray1.86A/B878-1347[»]
5FYMX-ray2.00A/B878-1347[»]
SMRiO14607
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113247, 6 interactors
DIPiDIP-48650N
IntActiO14607, 3 interactors

PTM databases

iPTMnetiO14607
PhosphoSitePlusiO14607

Polymorphism and mutation databases

BioMutaiUTY

Proteomic databases

jPOSTiO14607
MaxQBiO14607
PaxDbiO14607
PeptideAtlasiO14607
PRIDEiO14607
ProteomicsDBi48111
48112 [O14607-2]
48113 [O14607-3]
TopDownProteomicsiO14607-2 [O14607-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
7404
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329134; ENSP00000330446; ENSG00000183878 [O14607-2]
ENST00000331397; ENSP00000328939; ENSG00000183878 [O14607-1]
ENST00000362096; ENSP00000355420; ENSG00000183878 [O14607-3]
ENST00000382896; ENSP00000372352; ENSG00000183878 [O14607-4]
ENST00000624098; ENSP00000485539; ENSG00000183878 [O14607-5]
GeneIDi7404
KEGGihsa:7404
UCSCiuc004fsx.3 human [O14607-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7404
DisGeNETi7404

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UTY

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0056663
HGNCiHGNC:12638 UTY
HPAiHPA000568
HPA001165
MIMi400009 gene
neXtProtiNX_O14607
OpenTargetsiENSG00000183878
PharmGKBiPA37263

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1124 Eukaryota
KOG1246 Eukaryota
COG0457 LUCA
GeneTreeiENSGT00940000155202
HOGENOMiHOG000220834
InParanoidiO14607
KOiK11447
OrthoDBi268901at2759
PhylomeDBiO14607
TreeFamiTF317405

Enzyme and pathway databases

ReactomeiR-HSA-3214842 HDMs demethylate histones

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UTY human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
UTY_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7404

Protein Ontology

More...
PROi
PR:O14607

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000183878 Expressed in 190 organ(s), highest expression level in corpus callosum
ExpressionAtlasiO14607 baseline and differential
GenevisibleiO14607 HS

Family and domain databases

Gene3Di1.25.40.10, 2 hits
InterProiView protein in InterPro
IPR003347 JmjC_dom
IPR029516 KDM6C
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PANTHERiPTHR14017:SF25 PTHR14017:SF25, 2 hits
PfamiView protein in Pfam
PF02373 JmjC, 1 hit
PF13181 TPR_8, 1 hit
SMARTiView protein in SMART
SM00558 JmjC, 1 hit
SM00028 TPR, 7 hits
SUPFAMiSSF48452 SSF48452, 3 hits
PROSITEiView protein in PROSITE
PS51184 JMJC, 1 hit
PS50005 TPR, 7 hits
PS50293 TPR_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUTY_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O14607
Secondary accession number(s): A8K9Z3
, E1U199, E1U1A0, F5H4V7, F8W8R7, O14608
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: April 14, 2009
Last modified: May 8, 2019
This is version 170 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome Y
    Human chromosome Y: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again