Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytoplasmic dynein 1 intermediate chain 1

Gene

DYNC1I1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. May play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.

GO - Molecular functioni

  • dynein heavy chain binding Source: GO_Central
  • dynein light chain binding Source: GO_Central
  • microtubule binding Source: HGNC
  • microtubule motor activity Source: HGNC
  • motor activity Source: ProtInc
  • spectrin binding Source: MGI

GO - Biological processi

Keywordsi

Molecular functionMotor protein
Biological processTransport

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2132295 MHC class II antigen presentation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3371497 HSP90 chaperone cycle for steroid hormone receptors (SHR)
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic
R-HSA-68877 Mitotic Prometaphase
SignaLinkiO14576

Names & Taxonomyi

Protein namesi
Recommended name:
Cytoplasmic dynein 1 intermediate chain 1
Alternative name(s):
Cytoplasmic dynein intermediate chain 1
Dynein intermediate chain 1, cytosolic
Short name:
DH IC-1
Gene namesi
Name:DYNC1I1
Synonyms:DNCI1, DNCIC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000158560.14
HGNCiHGNC:2963 DYNC1I1
MIMi603772 gene
neXtProtiNX_O14576

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Dynein, Kinetochore, Microtubule

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi148L → G: Disrupts interaction with DYNLT1. 1 Publication1
Mutagenesisi149G → E: No effect on interaction with DYNLT1. 1 Publication1
Mutagenesisi150V → G: Disrupts interaction with DYNLT1. 1 Publication1
Mutagenesisi150V → W: No effect on interaction with DYNLT1. 1 Publication1
Mutagenesisi152K → A or Y: No effect on interaction with DYNLT1. 1 Publication1
Mutagenesisi153V → G: Decreases interaction with DYNLT1. 1 Publication1
Mutagenesisi155Q → H, R, T or Y: No effect on interaction with DYNLT1. 1 Publication1
Mutagenesisi156V → G: Decreases interaction with DYNLT1. 1 Publication1
Mutagenesisi157D → R: No effect on interaction with DYNLT1. 1 Publication1
Mutagenesisi158F → G: Disrupts interaction with DYNLT1. 1 Publication1

Organism-specific databases

DisGeNETi1780
OpenTargetsiENSG00000158560
PharmGKBiPA27434

Polymorphism and mutation databases

BioMutaiDYNC1I1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001146522 – 645Cytoplasmic dynein 1 intermediate chain 1Add BLAST644

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1
Modified residuei50PhosphoserineBy similarity1
Modified residuei100PhosphoserineBy similarity1
Modified residuei105PhosphothreonineBy similarity1
Modified residuei107PhosphoserineBy similarity1
Modified residuei111PhosphoserineBy similarity1
Modified residuei114PhosphoserineBy similarity1
Modified residuei176PhosphothreonineBy similarity1
Modified residuei179PhosphoserineBy similarity1
Modified residuei197PhosphoserineBy similarity1
Modified residuei635PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO14576
MaxQBiO14576
PaxDbiO14576
PeptideAtlasiO14576
PRIDEiO14576
ProteomicsDBi48091
48092 [O14576-2]
48093 [O14576-3]
TopDownProteomicsiO14576-3 [O14576-3]

PTM databases

iPTMnetiO14576
PhosphoSitePlusiO14576

Expressioni

Gene expression databases

BgeeiENSG00000158560
CleanExiHS_DYNC1I1
ExpressionAtlasiO14576 baseline and differential
GenevisibleiO14576 HS

Organism-specific databases

HPAiHPA061689

Interactioni

Subunit structurei

Homodimer (By similarity). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. Interacts with DYNC1H1. Interacts with DYNLT1 and DYNLT3. Interacts with DCNT1 (By similarity).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
Nde1Q9CZA62EBI-366267,EBI-309934From Mus musculus.

GO - Molecular functioni

Protein-protein interaction databases

BioGridi108118, 56 interactors
CORUMiO14576
ELMiO14576
IntActiO14576, 36 interactors
MINTiO14576
STRINGi9606.ENSP00000320130

Structurei

3D structure databases

ProteinModelPortaliO14576
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati285 – 334WD 1Add BLAST50
Repeati338 – 378WD 2Add BLAST41
Repeati387 – 428WD 3Add BLAST42
Repeati437 – 477WD 4Add BLAST41
Repeati482 – 527WD 5Add BLAST46
Repeati530 – 570WD 6Add BLAST41
Repeati576 – 615WD 7Add BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni2 – 123Interaction with DCTN1By similarityAdd BLAST122
Regioni147 – 163Interaction with DYNLT11 PublicationAdd BLAST17

Sequence similaritiesi

Belongs to the dynein intermediate chain family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1587 Eukaryota
ENOG410XQ99 LUCA
GeneTreeiENSGT00730000110228
HOGENOMiHOG000116383
HOVERGENiHBG004083
InParanoidiO14576
KOiK10415
OMAiVEPKVGH
OrthoDBiEOG091G038G
PhylomeDBiO14576
TreeFamiTF300553

Family and domain databases

Gene3Di2.130.10.10, 2 hits
InterProiView protein in InterPro
IPR025956 DYNC1I1/DYNC1I2
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF11540 Dynein_IC2, 1 hit
PF00400 WD40, 1 hit
SMARTiView protein in SMART
SM00320 WD40, 5 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O14576-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDKSDLKAE LERKKQRLAQ IREEKKRKEE ERKKKEADMQ QKKEPVQDDS
60 70 80 90 100
DLDRKRRETE ALLQSIGISP EPPLVQPLHF LTWDTCYFHY LVPTPMSPSS
110 120 130 140 150
KSVSTPSEAG SQDSGDLGPL TRTLQWDTDP SVLQLQSDSE LGRRLHKLGV
160 170 180 190 200
SKVTQVDFLP REVVSYSKET QTPLATHQSE EDEEDEEMVE SKVGQDSELE
210 220 230 240 250
NQDKKQEVKE APPRELTEEE KQQILHSEEF LIFFDRTIRV IERALAEDSD
260 270 280 290 300
IFFDYSGREL EEKDGDVQAG ANLSFNRQFY DEHWSKHRVV TCMDWSLQYP
310 320 330 340 350
ELMVASYNNN EDAPHEPDGV ALVWNMKFKK TTPEYVFHCQ SSVMSVCFAR
360 370 380 390 400
FHPNLVVGGT YSGQIVLWDN RSHRRTPVQR TPLSAAAHTH PVYCVNVVGT
410 420 430 440 450
QNAHNLITVS TDGKMCSWSL DMLSTPQESM ELVYNKSKPV AVTGMAFPTG
460 470 480 490 500
DVNNFVVGSE EGTVYTACRH GSKAGIGEVF EGHQGPVTGI NCHMAVGPID
510 520 530 540 550
FSHLFVTSSF DWTVKLWTTK HNKPLYSFED NADYVYDVMW SPVHPALFAC
560 570 580 590 600
VDGMGRLDLW NLNNDTEVPT ASVAIEGASA LNRVRWAQAG KEVAVGDSEG
610 620 630 640
RIWVYDVGEL AVPHNDEWTR FARTLVEIRA NRADSEEEGT VELSA
Length:645
Mass (Da):72,955
Last modified:May 1, 1999 - v2
Checksum:i55A6FF971E632DA0
GO
Isoform 2 (identifier: O14576-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.

Show »
Length:628
Mass (Da):70,790
Checksum:i0360B15D5295971F
GO
Isoform 3 (identifier: O14576-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.
     123-142: Missing.

Show »
Length:608
Mass (Da):68,575
Checksum:iD88D3EB3D1FC82B2
GO
Isoform 4 (identifier: O14576-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.
     123-142: Missing.
     610-645: LAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA → GLAMLPGWSQNSWTQAILLCWPPKVLGLQT

Note: No experimental confirmation available.
Show »
Length:602
Mass (Da):67,802
Checksum:iC72E232C21BED944
GO
Isoform 5 (identifier: O14576-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-142: Missing.

Note: No experimental confirmation available.
Show »
Length:625
Mass (Da):70,741
Checksum:iE9675FAE856C56F1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti254D → G in BAG59855 (PubMed:14702039).Curated1
Sequence conflicti517W → C in AAH22540 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_064709373H → L Found in a renal cell carcinoma case; somatic mutation. 1 Publication1
Natural variantiVAR_048905582N → T. Corresponds to variant dbSNP:rs35077523Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00133274 – 90Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_001333123 – 142Missing in isoform 3, isoform 4 and isoform 5. 3 PublicationsAdd BLAST20
Alternative sequenceiVSP_054766610 – 645LAVPH…VELSA → GLAMLPGWSQNSWTQAILLC WPPKVLGLQT in isoform 4. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF063228 mRNA Translation: AAC33443.1
AF123074 mRNA Translation: AAD26852.1
AK091339 mRNA Translation: BAC03639.1
AK297427 mRNA Translation: BAG59855.1
AC022261 Genomic DNA No translation available.
AC091779 Genomic DNA No translation available.
AC002452 Genomic DNA Translation: AAB67047.2
AC002540 Genomic DNA Translation: AAB70113.1
CH471091 Genomic DNA Translation: EAW76753.1
BC022540 mRNA Translation: AAH22540.1
CCDSiCCDS47645.1 [O14576-2]
CCDS47646.1 [O14576-3]
CCDS5644.1 [O14576-1]
CCDS64718.1 [O14576-5]
CCDS64719.1 [O14576-4]
RefSeqiNP_001129028.1, NM_001135556.1 [O14576-2]
NP_001129029.1, NM_001135557.1 [O14576-3]
NP_001265350.1, NM_001278421.1 [O14576-5]
NP_001265351.1, NM_001278422.1 [O14576-4]
NP_004402.1, NM_004411.4 [O14576-1]
XP_011514163.1, XM_011515861.1 [O14576-1]
XP_011514164.1, XM_011515862.1 [O14576-2]
XP_016867293.1, XM_017011804.1 [O14576-1]
XP_016867294.1, XM_017011805.1 [O14576-2]
UniGeneiHs.440364

Genome annotation databases

EnsembliENST00000324972; ENSP00000320130; ENSG00000158560 [O14576-1]
ENST00000359388; ENSP00000352348; ENSG00000158560 [O14576-3]
ENST00000437599; ENSP00000398118; ENSG00000158560 [O14576-5]
ENST00000447467; ENSP00000392337; ENSG00000158560 [O14576-2]
ENST00000457059; ENSP00000412444; ENSG00000158560 [O14576-2]
ENST00000630942; ENSP00000486363; ENSG00000158560 [O14576-4]
GeneIDi1780
KEGGihsa:1780
UCSCiuc003uob.4 human [O14576-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiDC1I1_HUMAN
AccessioniPrimary (citable) accession number: O14576
Secondary accession number(s): B4DME3
, F5H050, G5E9K1, Q8TBF7, Q9Y2X1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: June 20, 2018
This is version 166 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health