Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O14576 (DC1I1_HUMAN)

Protein

Cytoplasmic dynein 1 intermediate chain 1

Gene

DYNC1I1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. May play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • dynein heavy chain binding Source: GO_Central
  • dynein light chain binding Source: GO_Central
  • microtubule binding Source: HGNC
  • microtubule motor activity Source: HGNC
  • motor activity Source: ProtInc
  • spectrin binding Source: MGI
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
Biological processTransport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2132295 MHC class II antigen presentation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3371497 HSP90 chaperone cycle for steroid hormone receptors (SHR)
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic
R-HSA-68877 Mitotic Prometaphase

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O14576

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytoplasmic dynein 1 intermediate chain 1
Alternative name(s):
Cytoplasmic dynein intermediate chain 1
Dynein intermediate chain 1, cytosolic
Short name:
DH IC-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DYNC1I1
Synonyms:DNCI1, DNCIC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000158560.14

Human Gene Nomenclature Database

More...HGNCi		HGNC:2963 DYNC1I1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603772 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O14576

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Dynein, Kinetochore, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi148L → G: Disrupts interaction with DYNLT1. 1 Publication1
Mutagenesisi149G → E: No effect on interaction with DYNLT1. 1 Publication1
Mutagenesisi150V → G: Disrupts interaction with DYNLT1. 1 Publication1
Mutagenesisi150V → W: No effect on interaction with DYNLT1. 1 Publication1
Mutagenesisi152K → A or Y: No effect on interaction with DYNLT1. 1 Publication1
Mutagenesisi153V → G: Decreases interaction with DYNLT1. 1 Publication1
Mutagenesisi155Q → H, R, T or Y: No effect on interaction with DYNLT1. 1 Publication1
Mutagenesisi156V → G: Decreases interaction with DYNLT1. 1 Publication1
Mutagenesisi157D → R: No effect on interaction with DYNLT1. 1 Publication1
Mutagenesisi158F → G: Disrupts interaction with DYNLT1. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		1780

Open Targets

More...OpenTargetsi		ENSG00000158560

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA27434

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		DYNC1I1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001146522 – 645Cytoplasmic dynein 1 intermediate chain 1Add BLAST644

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineBy similarity1
Modified residuei50PhosphoserineBy similarity1
Modified residuei100PhosphoserineBy similarity1
Modified residuei105PhosphothreonineBy similarity1
Modified residuei107PhosphoserineBy similarity1
Modified residuei111PhosphoserineBy similarity1
Modified residuei114PhosphoserineBy similarity1
Modified residuei176PhosphothreonineBy similarity1
Modified residuei179PhosphoserineBy similarity1
Modified residuei197PhosphoserineBy similarity1
Modified residuei635PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O14576

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O14576

MaxQB - The MaxQuant DataBase

More...MaxQBi		O14576

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O14576

PeptideAtlas

More...PeptideAtlasi		O14576

PRoteomics IDEntifications database

More...PRIDEi		O14576

ProteomicsDB human proteome resource

More...ProteomicsDBi		48091
48092 [O14576-2]
48093 [O14576-3]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		O14576-3 [O14576-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O14576

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O14576

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000158560 Expressed in 189 organ(s), highest expression level in substantia nigra

CleanEx database of gene expression profiles

More...CleanExi		HS_DYNC1I1

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O14576 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O14576 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA061689

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (By similarity). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. Interacts with DYNC1H1. Interacts with DYNLT1 and DYNLT3. Interacts with DCNT1 (By similarity).By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Nde1Q9CZA62EBI-366267,EBI-309934From Mus musculus.

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		108118, 56 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O14576

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		O14576

Protein interaction database and analysis system

More...IntActi		O14576, 36 interactors

Molecular INTeraction database

More...MINTi		O14576

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000320130

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		O14576

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati285 – 334WD 1Add BLAST50
Repeati338 – 378WD 2Add BLAST41
Repeati387 – 428WD 3Add BLAST42
Repeati437 – 477WD 4Add BLAST41
Repeati482 – 527WD 5Add BLAST46
Repeati530 – 570WD 6Add BLAST41
Repeati576 – 615WD 7Add BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni2 – 123Interaction with DCTN1By similarityAdd BLAST122
Regioni147 – 163Interaction with DYNLT11 PublicationAdd BLAST17

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the dynein intermediate chain family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1587 Eukaryota
ENOG410XQ99 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156032

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000116383

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG004083

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O14576

KEGG Orthology (KO)

More...KOi		K10415

Identification of Orthologs from Complete Genome Data

More...OMAi		VEPKVGH

Database of Orthologous Groups

More...OrthoDBi		1453532at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O14576

TreeFam database of animal gene trees

More...TreeFami		TF300553

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.130.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR025956 DYNC1I1/DYNC1I2
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF11540 Dynein_IC2, 1 hit
PF00400 WD40, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00320 WD40, 5 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50978 SSF50978, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O14576-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDKSDLKAE LERKKQRLAQ IREEKKRKEE ERKKKEADMQ QKKEPVQDDS 
        60         70         80         90        100
DLDRKRRETE ALLQSIGISP EPPLVQPLHF LTWDTCYFHY LVPTPMSPSS 
       110        120        130        140        150
KSVSTPSEAG SQDSGDLGPL TRTLQWDTDP SVLQLQSDSE LGRRLHKLGV 
       160        170        180        190        200
SKVTQVDFLP REVVSYSKET QTPLATHQSE EDEEDEEMVE SKVGQDSELE 
       210        220        230        240        250
NQDKKQEVKE APPRELTEEE KQQILHSEEF LIFFDRTIRV IERALAEDSD 
       260        270        280        290        300
IFFDYSGREL EEKDGDVQAG ANLSFNRQFY DEHWSKHRVV TCMDWSLQYP 
       310        320        330        340        350
ELMVASYNNN EDAPHEPDGV ALVWNMKFKK TTPEYVFHCQ SSVMSVCFAR 
       360        370        380        390        400
FHPNLVVGGT YSGQIVLWDN RSHRRTPVQR TPLSAAAHTH PVYCVNVVGT 
       410        420        430        440        450
QNAHNLITVS TDGKMCSWSL DMLSTPQESM ELVYNKSKPV AVTGMAFPTG 
       460        470        480        490        500
DVNNFVVGSE EGTVYTACRH GSKAGIGEVF EGHQGPVTGI NCHMAVGPID 
       510        520        530        540        550
FSHLFVTSSF DWTVKLWTTK HNKPLYSFED NADYVYDVMW SPVHPALFAC 
       560        570        580        590        600
VDGMGRLDLW NLNNDTEVPT ASVAIEGASA LNRVRWAQAG KEVAVGDSEG 
       610        620        630        640 
RIWVYDVGEL AVPHNDEWTR FARTLVEIRA NRADSEEEGT VELSA
Length:645
Mass (Da):72,955
Last modified:May 1, 1999 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i55A6FF971E632DA0
GO
Isoform 2 (identifier: O14576-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.

Show »
Length:628
Mass (Da):70,790
Checksum:i0360B15D5295971F
GO
Isoform 3 (identifier: O14576-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.
     123-142: Missing.

Show »
Length:608
Mass (Da):68,575
Checksum:iD88D3EB3D1FC82B2
GO
Isoform 4 (identifier: O14576-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.
     123-142: Missing.
     610-645: LAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA → GLAMLPGWSQNSWTQAILLCWPPKVLGLQT

Note: No experimental confirmation available.
Show »
Length:602
Mass (Da):67,802
Checksum:iC72E232C21BED944
GO
Isoform 5 (identifier: O14576-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-142: Missing.

Note: No experimental confirmation available.
Show »
Length:625
Mass (Da):70,741
Checksum:iE9675FAE856C56F1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MTG2A0A0A0MTG2_HUMAN
Cytoplasmic dynein 1 intermediate c...
DYNC1I1
544Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J3E7C9J3E7_HUMAN
Cytoplasmic dynein 1 intermediate c...
DYNC1I1
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RFE1E5RFE1_HUMAN
Cytoplasmic dynein 1 intermediate c...
DYNC1I1
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJ75E5RJ75_HUMAN
Cytoplasmic dynein 1 intermediate c...
DYNC1I1
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti254D → G in BAG59855 (PubMed:14702039).Curated1
Sequence conflicti517W → C in AAH22540 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_064709373H → L Found in a renal cell carcinoma case; somatic mutation. 1 Publication1
Natural variantiVAR_048905582N → T. Corresponds to variant dbSNP:rs35077523Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00133274 – 90Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_001333123 – 142Missing in isoform 3, isoform 4 and isoform 5. 3 PublicationsAdd BLAST20
Alternative sequenceiVSP_054766610 – 645LAVPH…VELSA → GLAMLPGWSQNSWTQAILLC WPPKVLGLQT in isoform 4. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF063228 mRNA Translation: AAC33443.1
AF123074 mRNA Translation: AAD26852.1
AK091339 mRNA Translation: BAC03639.1
AK297427 mRNA Translation: BAG59855.1
AC022261 Genomic DNA No translation available.
AC091779 Genomic DNA No translation available.
AC002452 Genomic DNA Translation: AAB67047.2
AC002540 Genomic DNA Translation: AAB70113.1
CH471091 Genomic DNA Translation: EAW76753.1
BC022540 mRNA Translation: AAH22540.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS47645.1 [O14576-2]
CCDS47646.1 [O14576-3]
CCDS5644.1 [O14576-1]
CCDS64718.1 [O14576-5]
CCDS64719.1 [O14576-4]

NCBI Reference Sequences

More...RefSeqi		NP_001129028.1, NM_001135556.1 [O14576-2]
NP_001129029.1, NM_001135557.1 [O14576-3]
NP_001265350.1, NM_001278421.1 [O14576-5]
NP_001265351.1, NM_001278422.1 [O14576-4]
NP_004402.1, NM_004411.4 [O14576-1]
XP_011514163.1, XM_011515861.1 [O14576-1]
XP_011514164.1, XM_011515862.1
XP_016867293.1, XM_017011804.1 [O14576-1]
XP_016867294.1, XM_017011805.1 [O14576-2]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.440364

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000324972; ENSP00000320130; ENSG00000158560 [O14576-1]
ENST00000359388; ENSP00000352348; ENSG00000158560 [O14576-3]
ENST00000437599; ENSP00000398118; ENSG00000158560 [O14576-5]
ENST00000447467; ENSP00000392337; ENSG00000158560 [O14576-2]
ENST00000457059; ENSP00000412444; ENSG00000158560 [O14576-2]
ENST00000630942; ENSP00000486363; ENSG00000158560 [O14576-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		1780

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:1780

UCSC genome browser

More...UCSCi		uc003uob.4 human [O14576-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF063228 mRNA Translation: AAC33443.1
AF123074 mRNA Translation: AAD26852.1
AK091339 mRNA Translation: BAC03639.1
AK297427 mRNA Translation: BAG59855.1
AC022261 Genomic DNA No translation available.
AC091779 Genomic DNA No translation available.
AC002452 Genomic DNA Translation: AAB67047.2
AC002540 Genomic DNA Translation: AAB70113.1
CH471091 Genomic DNA Translation: EAW76753.1
BC022540 mRNA Translation: AAH22540.1
CCDSiCCDS47645.1 [O14576-2]
CCDS47646.1 [O14576-3]
CCDS5644.1 [O14576-1]
CCDS64718.1 [O14576-5]
CCDS64719.1 [O14576-4]
RefSeqiNP_001129028.1, NM_001135556.1 [O14576-2]
NP_001129029.1, NM_001135557.1 [O14576-3]
NP_001265350.1, NM_001278421.1 [O14576-5]
NP_001265351.1, NM_001278422.1 [O14576-4]
NP_004402.1, NM_004411.4 [O14576-1]
XP_011514163.1, XM_011515861.1 [O14576-1]
XP_011514164.1, XM_011515862.1
XP_016867293.1, XM_017011804.1 [O14576-1]
XP_016867294.1, XM_017011805.1 [O14576-2]
UniGeneiHs.440364

3D structure databases

ProteinModelPortaliO14576
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108118, 56 interactors
CORUMiO14576
ELMiO14576
IntActiO14576, 36 interactors
MINTiO14576
STRINGi9606.ENSP00000320130

PTM databases

iPTMnetiO14576
PhosphoSitePlusiO14576

Polymorphism and mutation databases

BioMutaiDYNC1I1

Proteomic databases

EPDiO14576
jPOSTiO14576
MaxQBiO14576
PaxDbiO14576
PeptideAtlasiO14576
PRIDEiO14576
ProteomicsDBi48091
48092 [O14576-2]
48093 [O14576-3]
TopDownProteomicsiO14576-3 [O14576-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000324972; ENSP00000320130; ENSG00000158560 [O14576-1]
ENST00000359388; ENSP00000352348; ENSG00000158560 [O14576-3]
ENST00000437599; ENSP00000398118; ENSG00000158560 [O14576-5]
ENST00000447467; ENSP00000392337; ENSG00000158560 [O14576-2]
ENST00000457059; ENSP00000412444; ENSG00000158560 [O14576-2]
ENST00000630942; ENSP00000486363; ENSG00000158560 [O14576-4]
GeneIDi1780
KEGGihsa:1780
UCSCiuc003uob.4 human [O14576-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1780
DisGeNETi1780
EuPathDBiHostDB:ENSG00000158560.14

GeneCards: human genes, protein and diseases

More...GeneCardsi		DYNC1I1
HGNCiHGNC:2963 DYNC1I1
HPAiHPA061689
MIMi603772 gene
neXtProtiNX_O14576
OpenTargetsiENSG00000158560
PharmGKBiPA27434

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1587 Eukaryota
ENOG410XQ99 LUCA
GeneTreeiENSGT00940000156032
HOGENOMiHOG000116383
HOVERGENiHBG004083
InParanoidiO14576
KOiK10415
OMAiVEPKVGH
OrthoDBi1453532at2759
PhylomeDBiO14576
TreeFamiTF300553

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2132295 MHC class II antigen presentation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3371497 HSP90 chaperone cycle for steroid hormone receptors (SHR)
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic
R-HSA-68877 Mitotic Prometaphase
SignaLinkiO14576

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		DYNC1I1 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		DYNC1I1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		1780

Protein Ontology

More...PROi		PR:O14576

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000158560 Expressed in 189 organ(s), highest expression level in substantia nigra
CleanExiHS_DYNC1I1
ExpressionAtlasiO14576 baseline and differential
GenevisibleiO14576 HS

Family and domain databases

Gene3Di2.130.10.10, 2 hits
InterProiView protein in InterPro
IPR025956 DYNC1I1/DYNC1I2
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF11540 Dynein_IC2, 1 hit
PF00400 WD40, 1 hit
SMARTiView protein in SMART
SM00320 WD40, 5 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDC1I1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O14576
Secondary accession number(s): B4DME3
, F5H050, G5E9K1, Q8TBF7, Q9Y2X1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: January 16, 2019
This is version 171 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again