Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thioredoxin domain-containing protein 9

Gene

TXNDC9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.1 Publication

GO - Molecular functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Thioredoxin domain-containing protein 9
Alternative name(s):
ATP-binding protein associated with cell differentiation
Protein 1-4
Gene namesi
Name:TXNDC9
Synonyms:APACD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000115514.11
HGNCiHGNC:24110 TXNDC9
MIMi612564 gene
neXtProtiNX_O14530

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000115514
PharmGKBiPA134957934

Polymorphism and mutation databases

BioMutaiTXNDC9

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001201661 – 226Thioredoxin domain-containing protein 9Add BLAST226

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei188PhosphoserineCombined sources1
Modified residuei221PhosphoserineCombined sources1
Modified residuei223PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO14530
MaxQBiO14530
PaxDbiO14530
PeptideAtlasiO14530
PRIDEiO14530
ProteomicsDBi48076

PTM databases

iPTMnetiO14530
PhosphoSitePlusiO14530

Expressioni

Gene expression databases

BgeeiENSG00000115514 Expressed in 229 organ(s), highest expression level in testis
CleanExiHS_TXNDC9
ExpressionAtlasiO14530 baseline and differential
GenevisibleiO14530 HS

Organism-specific databases

HPAiHPA031844
HPA031845
HPA031846

Interactioni

Subunit structurei

Forms ternary complexes with the chaperonin TCP1 complex, spanning the cylindrical chaperonin cavity and contacting at least 2 subunits.

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115487, 80 interactors
IntActiO14530, 46 interactors
MINTiO14530
STRINGi9606.ENSP00000264255

Structurei

3D structure databases

ProteinModelPortaliO14530
SMRiO14530
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini74 – 180ThioredoxinAdd BLAST107

Phylogenomic databases

eggNOGiKOG1672 Eukaryota
COG0526 LUCA
GeneTreeiENSGT00390000015645
HOVERGENiHBG054120
InParanoidiO14530
OMAiVVCHFYK
OrthoDBiEOG091G0RBF
PhylomeDBiO14530
TreeFamiTF313442

Family and domain databases

InterProiView protein in InterPro
IPR036249 Thioredoxin-like_sf
IPR013766 Thioredoxin_domain
PfamiView protein in Pfam
PF00085 Thioredoxin, 1 hit
SUPFAMiSSF52833 SSF52833, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O14530-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEADASVDMF SKVLEHQLLQ TTKLVEEHLD SEIQKLDQMD EDELERLKEK
60 70 80 90 100
RLQALRKAQQ QKQEWLSKGH GEYREIPSER DFFQEVKESE NVVCHFYRDS
110 120 130 140 150
TFRCKILDRH LAILSKKHLE TKFLKLNVEK APFLCERLHI KVIPTLALLK
160 170 180 190 200
DGKTQDYVVG FTDLGNTDDF TTETLEWRLG SSDILNYSGN LMEPPFQNQK
210 220
KFGTNFTKLE KKTIRGKKYD SDSDDD
Length:226
Mass (Da):26,534
Last modified:September 19, 2002 - v2
Checksum:i2735A2562D1143C3
GO
Isoform 2 (identifier: O14530-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     188-226: SGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD → R

Note: No experimental confirmation available.
Show »
Length:188
Mass (Da):22,199
Checksum:iB375C22E69DF6523
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B8ZZX4B8ZZX4_HUMAN
Thioredoxin domain-containing prote...
TXNDC9
135Annotation score:
F8WCJ3F8WCJ3_HUMAN
Thioredoxin domain-containing prote...
TXNDC9
122Annotation score:
F8WBV5F8WBV5_HUMAN
Thioredoxin domain-containing prote...
TXNDC9
64Annotation score:
G3XAJ4G3XAJ4_HUMAN
Thioredoxin domain containing 9, is...
TXNDC9 hCG_1733674
74Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti122K → N in BAA21881 (Ref. 1) Curated1
Sequence conflicti190N → D in BAD96336 (Ref. 4) Curated1
Sequence conflicti214I → M in BAA21881 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05832814L → Q. Corresponds to variant dbSNP:rs11542369Ensembl.1
Natural variantiVAR_05832938Q → R. Corresponds to variant dbSNP:rs11542371Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056553188 – 226SGNLM…DSDDD → R in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006679 mRNA Translation: BAA21881.1
AK313777 mRNA Translation: BAG36515.1
CR456935 mRNA Translation: CAG33216.1
AK222616 mRNA Translation: BAD96336.1
AB451403 mRNA Translation: BAG70217.1
AC079447 Genomic DNA Translation: AAX93257.1
CH471127 Genomic DNA Translation: EAX01869.1
CH471127 Genomic DNA Translation: EAX01870.1
CH471127 Genomic DNA Translation: EAX01871.1
BC005968 mRNA Translation: AAH05968.1
BC022864 mRNA Translation: AAH22864.1
BC024223 mRNA Translation: AAH24223.2
BC070183 mRNA Translation: AAH70183.2
CCDSiCCDS2044.1 [O14530-1]
RefSeqiNP_005774.2, NM_005783.3 [O14530-1]
UniGeneiHs.536122

Genome annotation databases

EnsembliENST00000264255; ENSP00000264255; ENSG00000115514 [O14530-1]
ENST00000409434; ENSP00000387275; ENSG00000115514 [O14530-2]
GeneIDi10190
KEGGihsa:10190
UCSCiuc002szz.4 human [O14530-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006679 mRNA Translation: BAA21881.1
AK313777 mRNA Translation: BAG36515.1
CR456935 mRNA Translation: CAG33216.1
AK222616 mRNA Translation: BAD96336.1
AB451403 mRNA Translation: BAG70217.1
AC079447 Genomic DNA Translation: AAX93257.1
CH471127 Genomic DNA Translation: EAX01869.1
CH471127 Genomic DNA Translation: EAX01870.1
CH471127 Genomic DNA Translation: EAX01871.1
BC005968 mRNA Translation: AAH05968.1
BC022864 mRNA Translation: AAH22864.1
BC024223 mRNA Translation: AAH24223.2
BC070183 mRNA Translation: AAH70183.2
CCDSiCCDS2044.1 [O14530-1]
RefSeqiNP_005774.2, NM_005783.3 [O14530-1]
UniGeneiHs.536122

3D structure databases

ProteinModelPortaliO14530
SMRiO14530
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115487, 80 interactors
IntActiO14530, 46 interactors
MINTiO14530
STRINGi9606.ENSP00000264255

PTM databases

iPTMnetiO14530
PhosphoSitePlusiO14530

Polymorphism and mutation databases

BioMutaiTXNDC9

Proteomic databases

EPDiO14530
MaxQBiO14530
PaxDbiO14530
PeptideAtlasiO14530
PRIDEiO14530
ProteomicsDBi48076

Protocols and materials databases

DNASUi10190
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264255; ENSP00000264255; ENSG00000115514 [O14530-1]
ENST00000409434; ENSP00000387275; ENSG00000115514 [O14530-2]
GeneIDi10190
KEGGihsa:10190
UCSCiuc002szz.4 human [O14530-1]

Organism-specific databases

CTDi10190
EuPathDBiHostDB:ENSG00000115514.11
GeneCardsiTXNDC9
HGNCiHGNC:24110 TXNDC9
HPAiHPA031844
HPA031845
HPA031846
MIMi612564 gene
neXtProtiNX_O14530
OpenTargetsiENSG00000115514
PharmGKBiPA134957934
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1672 Eukaryota
COG0526 LUCA
GeneTreeiENSGT00390000015645
HOVERGENiHBG054120
InParanoidiO14530
OMAiVVCHFYK
OrthoDBiEOG091G0RBF
PhylomeDBiO14530
TreeFamiTF313442

Miscellaneous databases

ChiTaRSiTXNDC9 human
GeneWikiiTXNDC9
GenomeRNAii10190
PROiPR:O14530
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000115514 Expressed in 229 organ(s), highest expression level in testis
CleanExiHS_TXNDC9
ExpressionAtlasiO14530 baseline and differential
GenevisibleiO14530 HS

Family and domain databases

InterProiView protein in InterPro
IPR036249 Thioredoxin-like_sf
IPR013766 Thioredoxin_domain
PfamiView protein in Pfam
PF00085 Thioredoxin, 1 hit
SUPFAMiSSF52833 SSF52833, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTXND9_HUMAN
AccessioniPrimary (citable) accession number: O14530
Secondary accession number(s): B2R9G8
, D3DVI4, Q53HG4, Q53RV8, Q6NSF5, Q8TB70, Q9BRU6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: September 19, 2002
Last modified: November 7, 2018
This is version 156 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again