Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pro-neuregulin-2, membrane-bound isoform

Gene

NRG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGrowth factor

Enzyme and pathway databases

ReactomeiR-HSA-1227986 Signaling by ERBB2
R-HSA-1236394 Signaling by ERBB4
R-HSA-1250196 SHC1 events in ERBB2 signaling
R-HSA-1250342 PI3K events in ERBB4 signaling
R-HSA-1250347 SHC1 events in ERBB4 signaling
R-HSA-1251985 Nuclear signaling by ERBB4
R-HSA-1257604 PIP3 activates AKT signaling
R-HSA-1306955 GRB7 events in ERBB2 signaling
R-HSA-1358803 Downregulation of ERBB2:ERBB3 signaling
R-HSA-1963640 GRB2 events in ERBB2 signaling
R-HSA-1963642 PI3K events in ERBB2 signaling
R-HSA-2219530 Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-6785631 ERBB2 Regulates Cell Motility
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-8847993 ERBB2 Activates PTK6 Signaling
R-HSA-8863795 Downregulation of ERBB2 signaling
SignaLinkiO14511
SIGNORiO14511

Names & Taxonomyi

Protein namesi
Recommended name:
Pro-neuregulin-2, membrane-bound isoform
Short name:
Pro-NRG2
Cleaved into the following chain:
Neuregulin-2
Short name:
NRG-2
Alternative name(s):
Divergent of neuregulin-1
Short name:
DON-1
Neural- and thymus-derived activator for ERBB kinases
Short name:
NTAK
Gene namesi
Name:NRG2
Synonyms:NTAK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000158458.19
HGNCiHGNC:7998 NRG2
MIMi603818 gene
neXtProtiNX_O14511

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini112 – 405ExtracellularSequence analysisAdd BLAST294
Transmembranei406 – 426Helical; Note=Internal signal sequenceSequence analysisAdd BLAST21
Topological domaini427 – 850CytoplasmicSequence analysisAdd BLAST424

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi9542
OpenTargetsiENSG00000158458
PharmGKBiPA31777

Polymorphism and mutation databases

BioMutaiNRG2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
PropeptideiPRO_00000194721 – 111By similarityAdd BLAST111
ChainiPRO_0000019473112 – 850Pro-neuregulin-2, membrane-bound isoformAdd BLAST739
ChainiPRO_0000019474112 – 404Neuregulin-2Add BLAST293

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi52N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi53N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi147N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi257 ↔ 311By similarity
Glycosylationi278N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi345 ↔ 359By similarity
Glycosylationi346N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi353 ↔ 370By similarity
Disulfide bondi372 ↔ 381By similarity

Post-translational modificationi

Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.By similarity
Extensive glycosylation precedes the proteolytic cleavage.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO14511
PeptideAtlasiO14511
PRIDEiO14511
ProteomicsDBi48047
48048 [O14511-2]
48049 [O14511-3]
48050 [O14511-4]
48051 [O14511-5]
48052 [O14511-6]
48053 [O14511-7]
48054 [O14511-8]

PTM databases

iPTMnetiO14511
PhosphoSitePlusiO14511

Expressioni

Tissue specificityi

Restricted to the cerebellum in the adult.

Gene expression databases

BgeeiENSG00000158458 Expressed in 166 organ(s), highest expression level in cerebellar vermis
CleanExiHS_NRG2
ExpressionAtlasiO14511 baseline and differential
GenevisibleiO14511 HS

Organism-specific databases

HPAiHPA038935
HPA047973

Interactioni

Subunit structurei

Interacts with ERBB3 and ERBB4.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114917, 2 interactors
STRINGi9606.ENSP00000354910

Structurei

3D structure databases

ProteinModelPortaliO14511
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini237 – 332Ig-like C2-typeAdd BLAST96
Domaini341 – 382EGF-likePROSITE-ProRule annotationAdd BLAST42

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi10 – 13Poly-Pro4
Compositional biasi20 – 30Poly-SerAdd BLAST11
Compositional biasi33 – 47Poly-SerAdd BLAST15
Compositional biasi87 – 90Poly-Ala4
Compositional biasi330 – 340Ser/Thr-richAdd BLAST11
Compositional biasi721 – 727Poly-Pro7

Domaini

The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization (By similarity).By similarity
ERBB receptor binding is elicited entirely by the EGF-like domain.By similarity

Sequence similaritiesi

Belongs to the neuregulin family.Curated

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGZW Eukaryota
ENOG410Y95Z LUCA
GeneTreeiENSGT00900000140940
HOGENOMiHOG000273863
HOVERGENiHBG006531
InParanoidiO14511
KOiK05456
OMAiATEHVIR
OrthoDBiEOG091G032E
PhylomeDBiO14511
TreeFamiTF332469

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR002154 Neuregulin_C
PfamiView protein in Pfam
PF07679 I-set, 1 hit
PF02158 Neuregulin, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00408 IGc2, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS50835 IG_LIKE, 1 hit

Sequences (8+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O14511-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRQVCCSALP PPPLEKGRCS SYSDSSSSSS ERSSSSSSSS SESGSSSRSS
60 70 80 90 100
SNNSSISRPA APPEPRPQQQ PQPRSPAARR AAARSRAAAA GGMRRDPAPG
110 120 130 140 150
FSMLLFGVSL ACYSPSLKSV QDQAYKAPVV VEGKVQGLVP AGGSSSNSTR
160 170 180 190 200
EPPASGRVAL VKVLDKWPLR SGGLQREQVI SVGSCVPLER NQRYIFFLEP
210 220 230 240 250
TEQPLVFKTA FAPLDTNGKN LKKEVGKILC TDCATRPKLK KMKSQTGQVG
260 270 280 290 300
EKQSLKCEAA AGNPQPSYRW FKDGKELNRS RDIRIKYGNG RKNSRLQFNK
310 320 330 340 350
VKVEDAGEYV CEAENILGKD TVRGRLYVNS VSTTLSSWSG HARKCNETAK
360 370 380 390 400
SYCVNGGVCY YIEGINQLSC KCPNGFFGQR CLEKLPLRLY MPDPKQKAEE
410 420 430 440 450
LYQKRVLTIT GICVALLVVG IVCVVAYCKT KKQRKQMHNH LRQNMCPAHQ
460 470 480 490 500
NRSLANGPSH PRLDPEEIQM ADYISKNVPA TDHVIRRETE TTFSGSHSCS
510 520 530 540 550
PSHHCSTATP TSSHRHESHT WSLERSESLT SDSQSGIMLS SVGTSKCNSP
560 570 580 590 600
ACVEARARRA AAYNLEERRR ATAPPYHDSV DSLRDSPHSE RYVSALTTPA
610 620 630 640 650
RLSPVDFHYS LATQVPTFEI TSPNSAHAVS LPPAAPISYR LAEQQPLLRH
660 670 680 690 700
PAPPGPGPGP GPGPGPGADM QRSYDSYYYP AAGPGPRRGT CALGGSLGSL
710 720 730 740 750
PASPFRIPED DEYETTQECA PPPPPRPRAR GASRRTSAGP RRWRRSRLNG
760 770 780 790 800
LAAQRARAAR DSLSLSSGSG GGSASASDDD ADDADGALAA ESTPFLGLRG
810 820 830 840 850
AHDALRSDSP PLCPAADSRT YYSLDSHSTR ASSRHSRGPP PRAKQDSAPL
Length:850
Mass (Da):91,679
Last modified:January 1, 1998 - v1
Checksum:i7124C089435FD2F4
GO
Isoform 2 (identifier: O14511-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     374-396: NGFFGQRCLEKLPLRLYMPDPKQ → VGYTGDRCQQFAMVNFS

Note: No experimental confirmation available.
Show »
Length:844
Mass (Da):90,851
Checksum:iA68F2D2C96C3C1C1
GO
Isoform 3 (identifier: O14511-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-397: K → KHLGFELKE

Note: No experimental confirmation available.
Show »
Length:858
Mass (Da):92,633
Checksum:i171976A9397EA0B1
GO
Isoform 4 (identifier: O14511-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     374-397: NGFFGQRCLEKLPLRLYMPDPKQK → VGYTGDRCQQFAMVNFSKHLGFELKE

Note: No experimental confirmation available.
Show »
Length:852
Mass (Da):91,805
Checksum:iFDE8AEB0E1C6F94B
GO
Isoform 5 (identifier: O14511-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-426: KAEELYQKRVLTITGICVALLVVGIVCVVA → SVLWDTPGTGVSSSQWSTSPKPRSCTRRGS
     427-850: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:426
Mass (Da):46,183
Checksum:iADC950AED919D5F4
GO
Isoform 6 (identifier: O14511-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-422: KAEELYQKRVLTITGICVALLVVGIV → SVLWDTPGTGVSSSQWSTSPSTLDLN
     423-850: Missing.

Note: No experimental confirmation available.
Show »
Length:422
Mass (Da):45,698
Checksum:i5CF05AF7A682310D
GO
Isoform DON-1B (identifier: O14511-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-241: Missing.
     397-397: K → KHLGFELKE

Show »
Length:617
Mass (Da):67,126
Checksum:i89A81CE27CE00B5C
GO
Isoform DON-1R (identifier: O14511-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-233: MRQVCCSALP...EVGKILCTDC → MSESRRRGRGRGKKHPEGRKREREPDPGEK

Show »
Length:647
Mass (Da):70,637
Checksum:iD1D5FDAF07CB3393
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GZS7F5GZS7_HUMAN
Pro-neuregulin-2, membrane-bound is...
NRG2
784Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0034521 – 241Missing in isoform DON-1B. 1 PublicationAdd BLAST241
Alternative sequenceiVSP_0034511 – 233MRQVC…LCTDC → MSESRRRGRGRGKKHPEGRK REREPDPGEK in isoform DON-1R. 1 PublicationAdd BLAST233
Alternative sequenceiVSP_003454374 – 397NGFFG…DPKQK → VGYTGDRCQQFAMVNFSKHL GFELKE in isoform 4. CuratedAdd BLAST24
Alternative sequenceiVSP_003453374 – 396NGFFG…PDPKQ → VGYTGDRCQQFAMVNFS in isoform 2. CuratedAdd BLAST23
Alternative sequenceiVSP_003458397 – 426KAEEL…VCVVA → SVLWDTPGTGVSSSQWSTSP KPRSCTRRGS in isoform 5. CuratedAdd BLAST30
Alternative sequenceiVSP_003456397 – 422KAEEL…VVGIV → SVLWDTPGTGVSSSQWSTSP STLDLN in isoform 6. CuratedAdd BLAST26
Alternative sequenceiVSP_003455397K → KHLGFELKE in isoform 3 and isoform DON-1B. 1 Publication1
Alternative sequenceiVSP_003457423 – 850Missing in isoform 6. CuratedAdd BLAST428
Alternative sequenceiVSP_003459427 – 850Missing in isoform 5. CuratedAdd BLAST424

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB005060 mRNA Translation: BAA23417.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28848.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28849.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28850.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28851.1
AF119158
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA Translation: AAF28852.1
AF119157
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA Translation: AAF28853.1
CCDSiCCDS4217.1 [O14511-1]
PIRiJC5700
RefSeqiNP_001171864.1, NM_001184935.1
NP_004874.1, NM_004883.2 [O14511-1]
NP_053584.1, NM_013981.3 [O14511-2]
NP_053585.1, NM_013982.2 [O14511-3]
NP_053586.1, NM_013983.2 [O14511-4]
XP_006714873.1, XM_006714810.3 [O14511-6]
UniGeneiHs.408515

Genome annotation databases

EnsembliENST00000289409; ENSP00000289409; ENSG00000158458 [O14511-2]
ENST00000289422; ENSP00000289422; ENSG00000158458 [O14511-3]
ENST00000340391; ENSP00000342660; ENSG00000158458 [O14511-8]
ENST00000358522; ENSP00000351323; ENSG00000158458 [O14511-4]
ENST00000361474; ENSP00000354910; ENSG00000158458 [O14511-1]
ENST00000378238; ENSP00000367483; ENSG00000158458 [O14511-5]
GeneIDi9542
KEGGihsa:9542
UCSCiuc003lev.3 human [O14511-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB005060 mRNA Translation: BAA23417.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28848.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28849.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28850.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28851.1
AF119158
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA Translation: AAF28852.1
AF119157
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA Translation: AAF28853.1
CCDSiCCDS4217.1 [O14511-1]
PIRiJC5700
RefSeqiNP_001171864.1, NM_001184935.1
NP_004874.1, NM_004883.2 [O14511-1]
NP_053584.1, NM_013981.3 [O14511-2]
NP_053585.1, NM_013982.2 [O14511-3]
NP_053586.1, NM_013983.2 [O14511-4]
XP_006714873.1, XM_006714810.3 [O14511-6]
UniGeneiHs.408515

3D structure databases

ProteinModelPortaliO14511
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114917, 2 interactors
STRINGi9606.ENSP00000354910

PTM databases

iPTMnetiO14511
PhosphoSitePlusiO14511

Polymorphism and mutation databases

BioMutaiNRG2

Proteomic databases

PaxDbiO14511
PeptideAtlasiO14511
PRIDEiO14511
ProteomicsDBi48047
48048 [O14511-2]
48049 [O14511-3]
48050 [O14511-4]
48051 [O14511-5]
48052 [O14511-6]
48053 [O14511-7]
48054 [O14511-8]

Protocols and materials databases

DNASUi9542
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000289409; ENSP00000289409; ENSG00000158458 [O14511-2]
ENST00000289422; ENSP00000289422; ENSG00000158458 [O14511-3]
ENST00000340391; ENSP00000342660; ENSG00000158458 [O14511-8]
ENST00000358522; ENSP00000351323; ENSG00000158458 [O14511-4]
ENST00000361474; ENSP00000354910; ENSG00000158458 [O14511-1]
ENST00000378238; ENSP00000367483; ENSG00000158458 [O14511-5]
GeneIDi9542
KEGGihsa:9542
UCSCiuc003lev.3 human [O14511-1]

Organism-specific databases

CTDi9542
DisGeNETi9542
EuPathDBiHostDB:ENSG00000158458.19
GeneCardsiNRG2
HGNCiHGNC:7998 NRG2
HPAiHPA038935
HPA047973
MIMi603818 gene
neXtProtiNX_O14511
OpenTargetsiENSG00000158458
PharmGKBiPA31777
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGZW Eukaryota
ENOG410Y95Z LUCA
GeneTreeiENSGT00900000140940
HOGENOMiHOG000273863
HOVERGENiHBG006531
InParanoidiO14511
KOiK05456
OMAiATEHVIR
OrthoDBiEOG091G032E
PhylomeDBiO14511
TreeFamiTF332469

Enzyme and pathway databases

ReactomeiR-HSA-1227986 Signaling by ERBB2
R-HSA-1236394 Signaling by ERBB4
R-HSA-1250196 SHC1 events in ERBB2 signaling
R-HSA-1250342 PI3K events in ERBB4 signaling
R-HSA-1250347 SHC1 events in ERBB4 signaling
R-HSA-1251985 Nuclear signaling by ERBB4
R-HSA-1257604 PIP3 activates AKT signaling
R-HSA-1306955 GRB7 events in ERBB2 signaling
R-HSA-1358803 Downregulation of ERBB2:ERBB3 signaling
R-HSA-1963640 GRB2 events in ERBB2 signaling
R-HSA-1963642 PI3K events in ERBB2 signaling
R-HSA-2219530 Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-6785631 ERBB2 Regulates Cell Motility
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-8847993 ERBB2 Activates PTK6 Signaling
R-HSA-8863795 Downregulation of ERBB2 signaling
SignaLinkiO14511
SIGNORiO14511

Miscellaneous databases

GeneWikiiNRG2
GenomeRNAii9542
PROiPR:O14511
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000158458 Expressed in 166 organ(s), highest expression level in cerebellar vermis
CleanExiHS_NRG2
ExpressionAtlasiO14511 baseline and differential
GenevisibleiO14511 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR002154 Neuregulin_C
PfamiView protein in Pfam
PF07679 I-set, 1 hit
PF02158 Neuregulin, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00408 IGc2, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS50835 IG_LIKE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNRG2_HUMAN
AccessioniPrimary (citable) accession number: O14511
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: January 1, 1998
Last modified: November 7, 2018
This is version 163 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again