Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pro-neuregulin-2, membrane-bound isoform

Gene

NRG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGrowth factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1227986 Signaling by ERBB2
R-HSA-1236394 Signaling by ERBB4
R-HSA-1250196 SHC1 events in ERBB2 signaling
R-HSA-1250342 PI3K events in ERBB4 signaling
R-HSA-1250347 SHC1 events in ERBB4 signaling
R-HSA-1251985 Nuclear signaling by ERBB4
R-HSA-1257604 PIP3 activates AKT signaling
R-HSA-1306955 GRB7 events in ERBB2 signaling
R-HSA-1358803 Downregulation of ERBB2:ERBB3 signaling
R-HSA-1963640 GRB2 events in ERBB2 signaling
R-HSA-1963642 PI3K events in ERBB2 signaling
R-HSA-2219530 Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-6785631 ERBB2 Regulates Cell Motility
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-8847993 ERBB2 Activates PTK6 Signaling
R-HSA-8863795 Downregulation of ERBB2 signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O14511

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O14511

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pro-neuregulin-2, membrane-bound isoform
Short name:
Pro-NRG2
Cleaved into the following chain:
Neuregulin-2
Short name:
NRG-2
Alternative name(s):
Divergent of neuregulin-1
Short name:
DON-1
Neural- and thymus-derived activator for ERBB kinases
Short name:
NTAK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NRG2
Synonyms:NTAK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000158458.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7998 NRG2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603818 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O14511

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini112 – 405ExtracellularSequence analysisAdd BLAST294
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei406 – 426Helical; Note=Internal signal sequenceSequence analysisAdd BLAST21
Topological domaini427 – 850CytoplasmicSequence analysisAdd BLAST424

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9542

Open Targets

More...
OpenTargetsi
ENSG00000158458

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31777

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NRG2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_00000194721 – 111By similarityAdd BLAST111
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000019473112 – 850Pro-neuregulin-2, membrane-bound isoformAdd BLAST739
ChainiPRO_0000019474112 – 404Neuregulin-2Add BLAST293

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi52N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi53N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi147N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi257 ↔ 311By similarity
Glycosylationi278N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi345 ↔ 359By similarity
Glycosylationi346N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi353 ↔ 370By similarity
Disulfide bondi372 ↔ 381By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.By similarity
Extensive glycosylation precedes the proteolytic cleavage.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O14511

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O14511

PeptideAtlas

More...
PeptideAtlasi
O14511

PRoteomics IDEntifications database

More...
PRIDEi
O14511

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48047
48048 [O14511-2]
48049 [O14511-3]
48050 [O14511-4]
48051 [O14511-5]
48052 [O14511-6]
48053 [O14511-7]
48054 [O14511-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O14511

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O14511

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Restricted to the cerebellum in the adult.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000158458 Expressed in 166 organ(s), highest expression level in cerebellar vermis

CleanEx database of gene expression profiles

More...
CleanExi
HS_NRG2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O14511 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O14511 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038935
HPA047973

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ERBB3 and ERBB4.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114917, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000354910

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O14511

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini237 – 332Ig-like C2-typeAdd BLAST96
Domaini341 – 382EGF-likePROSITE-ProRule annotationAdd BLAST42

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi10 – 13Poly-Pro4
Compositional biasi20 – 30Poly-SerAdd BLAST11
Compositional biasi33 – 47Poly-SerAdd BLAST15
Compositional biasi87 – 90Poly-Ala4
Compositional biasi330 – 340Ser/Thr-richAdd BLAST11
Compositional biasi721 – 727Poly-Pro7

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization (By similarity).By similarity
ERBB receptor binding is elicited entirely by the EGF-like domain.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the neuregulin family.Curated

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGZW Eukaryota
ENOG410Y95Z LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158778

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000273863

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006531

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O14511

KEGG Orthology (KO)

More...
KOi
K05456

Identification of Orthologs from Complete Genome Data

More...
OMAi
ATEHVIR

Database of Orthologous Groups

More...
OrthoDBi
313400at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O14511

TreeFam database of animal gene trees

More...
TreeFami
TF332469

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR040180 Neuregulin
IPR002154 Neuregulin_C

The PANTHER Classification System

More...
PANTHERi
PTHR11100 PTHR11100, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07679 I-set, 1 hit
PF02158 Neuregulin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409 IG, 1 hit
SM00408 IGc2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS50835 IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O14511-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRQVCCSALP PPPLEKGRCS SYSDSSSSSS ERSSSSSSSS SESGSSSRSS
60 70 80 90 100
SNNSSISRPA APPEPRPQQQ PQPRSPAARR AAARSRAAAA GGMRRDPAPG
110 120 130 140 150
FSMLLFGVSL ACYSPSLKSV QDQAYKAPVV VEGKVQGLVP AGGSSSNSTR
160 170 180 190 200
EPPASGRVAL VKVLDKWPLR SGGLQREQVI SVGSCVPLER NQRYIFFLEP
210 220 230 240 250
TEQPLVFKTA FAPLDTNGKN LKKEVGKILC TDCATRPKLK KMKSQTGQVG
260 270 280 290 300
EKQSLKCEAA AGNPQPSYRW FKDGKELNRS RDIRIKYGNG RKNSRLQFNK
310 320 330 340 350
VKVEDAGEYV CEAENILGKD TVRGRLYVNS VSTTLSSWSG HARKCNETAK
360 370 380 390 400
SYCVNGGVCY YIEGINQLSC KCPNGFFGQR CLEKLPLRLY MPDPKQKAEE
410 420 430 440 450
LYQKRVLTIT GICVALLVVG IVCVVAYCKT KKQRKQMHNH LRQNMCPAHQ
460 470 480 490 500
NRSLANGPSH PRLDPEEIQM ADYISKNVPA TDHVIRRETE TTFSGSHSCS
510 520 530 540 550
PSHHCSTATP TSSHRHESHT WSLERSESLT SDSQSGIMLS SVGTSKCNSP
560 570 580 590 600
ACVEARARRA AAYNLEERRR ATAPPYHDSV DSLRDSPHSE RYVSALTTPA
610 620 630 640 650
RLSPVDFHYS LATQVPTFEI TSPNSAHAVS LPPAAPISYR LAEQQPLLRH
660 670 680 690 700
PAPPGPGPGP GPGPGPGADM QRSYDSYYYP AAGPGPRRGT CALGGSLGSL
710 720 730 740 750
PASPFRIPED DEYETTQECA PPPPPRPRAR GASRRTSAGP RRWRRSRLNG
760 770 780 790 800
LAAQRARAAR DSLSLSSGSG GGSASASDDD ADDADGALAA ESTPFLGLRG
810 820 830 840 850
AHDALRSDSP PLCPAADSRT YYSLDSHSTR ASSRHSRGPP PRAKQDSAPL
Length:850
Mass (Da):91,679
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7124C089435FD2F4
GO
Isoform 2 (identifier: O14511-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     374-396: NGFFGQRCLEKLPLRLYMPDPKQ → VGYTGDRCQQFAMVNFS

Note: No experimental confirmation available.
Show »
Length:844
Mass (Da):90,851
Checksum:iA68F2D2C96C3C1C1
GO
Isoform 3 (identifier: O14511-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-397: K → KHLGFELKE

Note: No experimental confirmation available.
Show »
Length:858
Mass (Da):92,633
Checksum:i171976A9397EA0B1
GO
Isoform 4 (identifier: O14511-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     374-397: NGFFGQRCLEKLPLRLYMPDPKQK → VGYTGDRCQQFAMVNFSKHLGFELKE

Note: No experimental confirmation available.
Show »
Length:852
Mass (Da):91,805
Checksum:iFDE8AEB0E1C6F94B
GO
Isoform 5 (identifier: O14511-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-426: KAEELYQKRVLTITGICVALLVVGIVCVVA → SVLWDTPGTGVSSSQWSTSPKPRSCTRRGS
     427-850: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:426
Mass (Da):46,183
Checksum:iADC950AED919D5F4
GO
Isoform 6 (identifier: O14511-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-422: KAEELYQKRVLTITGICVALLVVGIV → SVLWDTPGTGVSSSQWSTSPSTLDLN
     423-850: Missing.

Note: No experimental confirmation available.
Show »
Length:422
Mass (Da):45,698
Checksum:i5CF05AF7A682310D
GO
Isoform DON-1B (identifier: O14511-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-241: Missing.
     397-397: K → KHLGFELKE

Show »
Length:617
Mass (Da):67,126
Checksum:i89A81CE27CE00B5C
GO
Isoform DON-1R (identifier: O14511-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-233: MRQVCCSALP...EVGKILCTDC → MSESRRRGRGRGKKHPEGRKREREPDPGEK

Show »
Length:647
Mass (Da):70,637
Checksum:iD1D5FDAF07CB3393
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GZS7F5GZS7_HUMAN
Pro-neuregulin-2, membrane-bound is...
NRG2
784Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0034521 – 241Missing in isoform DON-1B. 1 PublicationAdd BLAST241
Alternative sequenceiVSP_0034511 – 233MRQVC…LCTDC → MSESRRRGRGRGKKHPEGRK REREPDPGEK in isoform DON-1R. 1 PublicationAdd BLAST233
Alternative sequenceiVSP_003454374 – 397NGFFG…DPKQK → VGYTGDRCQQFAMVNFSKHL GFELKE in isoform 4. CuratedAdd BLAST24
Alternative sequenceiVSP_003453374 – 396NGFFG…PDPKQ → VGYTGDRCQQFAMVNFS in isoform 2. CuratedAdd BLAST23
Alternative sequenceiVSP_003458397 – 426KAEEL…VCVVA → SVLWDTPGTGVSSSQWSTSP KPRSCTRRGS in isoform 5. CuratedAdd BLAST30
Alternative sequenceiVSP_003456397 – 422KAEEL…VVGIV → SVLWDTPGTGVSSSQWSTSP STLDLN in isoform 6. CuratedAdd BLAST26
Alternative sequenceiVSP_003455397K → KHLGFELKE in isoform 3 and isoform DON-1B. 1 Publication1
Alternative sequenceiVSP_003457423 – 850Missing in isoform 6. CuratedAdd BLAST428
Alternative sequenceiVSP_003459427 – 850Missing in isoform 5. CuratedAdd BLAST424

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB005060 mRNA Translation: BAA23417.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28848.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28849.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28850.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28851.1
AF119158
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA Translation: AAF28852.1
AF119157
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA Translation: AAF28853.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4217.1 [O14511-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC5700

NCBI Reference Sequences

More...
RefSeqi
NP_001171864.1, NM_001184935.1
NP_004874.1, NM_004883.2 [O14511-1]
NP_053584.1, NM_013981.3 [O14511-2]
NP_053585.1, NM_013982.2 [O14511-3]
NP_053586.1, NM_013983.2 [O14511-4]
XP_006714873.1, XM_006714810.3 [O14511-6]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.408515

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000289409; ENSP00000289409; ENSG00000158458 [O14511-2]
ENST00000289422; ENSP00000289422; ENSG00000158458 [O14511-3]
ENST00000340391; ENSP00000342660; ENSG00000158458 [O14511-8]
ENST00000358522; ENSP00000351323; ENSG00000158458 [O14511-4]
ENST00000361474; ENSP00000354910; ENSG00000158458 [O14511-1]
ENST00000378238; ENSP00000367483; ENSG00000158458 [O14511-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9542

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9542

UCSC genome browser

More...
UCSCi
uc003lev.3 human [O14511-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB005060 mRNA Translation: BAA23417.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28848.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28849.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28850.1
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA Translation: AAF28851.1
AF119158
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA Translation: AAF28852.1
AF119157
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA Translation: AAF28853.1
CCDSiCCDS4217.1 [O14511-1]
PIRiJC5700
RefSeqiNP_001171864.1, NM_001184935.1
NP_004874.1, NM_004883.2 [O14511-1]
NP_053584.1, NM_013981.3 [O14511-2]
NP_053585.1, NM_013982.2 [O14511-3]
NP_053586.1, NM_013983.2 [O14511-4]
XP_006714873.1, XM_006714810.3 [O14511-6]
UniGeneiHs.408515

3D structure databases

ProteinModelPortaliO14511
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114917, 2 interactors
STRINGi9606.ENSP00000354910

PTM databases

iPTMnetiO14511
PhosphoSitePlusiO14511

Polymorphism and mutation databases

BioMutaiNRG2

Proteomic databases

jPOSTiO14511
PaxDbiO14511
PeptideAtlasiO14511
PRIDEiO14511
ProteomicsDBi48047
48048 [O14511-2]
48049 [O14511-3]
48050 [O14511-4]
48051 [O14511-5]
48052 [O14511-6]
48053 [O14511-7]
48054 [O14511-8]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9542
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000289409; ENSP00000289409; ENSG00000158458 [O14511-2]
ENST00000289422; ENSP00000289422; ENSG00000158458 [O14511-3]
ENST00000340391; ENSP00000342660; ENSG00000158458 [O14511-8]
ENST00000358522; ENSP00000351323; ENSG00000158458 [O14511-4]
ENST00000361474; ENSP00000354910; ENSG00000158458 [O14511-1]
ENST00000378238; ENSP00000367483; ENSG00000158458 [O14511-5]
GeneIDi9542
KEGGihsa:9542
UCSCiuc003lev.3 human [O14511-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9542
DisGeNETi9542
EuPathDBiHostDB:ENSG00000158458.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NRG2
HGNCiHGNC:7998 NRG2
HPAiHPA038935
HPA047973
MIMi603818 gene
neXtProtiNX_O14511
OpenTargetsiENSG00000158458
PharmGKBiPA31777

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGZW Eukaryota
ENOG410Y95Z LUCA
GeneTreeiENSGT00940000158778
HOGENOMiHOG000273863
HOVERGENiHBG006531
InParanoidiO14511
KOiK05456
OMAiATEHVIR
OrthoDBi313400at2759
PhylomeDBiO14511
TreeFamiTF332469

Enzyme and pathway databases

ReactomeiR-HSA-1227986 Signaling by ERBB2
R-HSA-1236394 Signaling by ERBB4
R-HSA-1250196 SHC1 events in ERBB2 signaling
R-HSA-1250342 PI3K events in ERBB4 signaling
R-HSA-1250347 SHC1 events in ERBB4 signaling
R-HSA-1251985 Nuclear signaling by ERBB4
R-HSA-1257604 PIP3 activates AKT signaling
R-HSA-1306955 GRB7 events in ERBB2 signaling
R-HSA-1358803 Downregulation of ERBB2:ERBB3 signaling
R-HSA-1963640 GRB2 events in ERBB2 signaling
R-HSA-1963642 PI3K events in ERBB2 signaling
R-HSA-2219530 Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-6785631 ERBB2 Regulates Cell Motility
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-8847993 ERBB2 Activates PTK6 Signaling
R-HSA-8863795 Downregulation of ERBB2 signaling
SignaLinkiO14511
SIGNORiO14511

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NRG2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9542

Protein Ontology

More...
PROi
PR:O14511

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000158458 Expressed in 166 organ(s), highest expression level in cerebellar vermis
CleanExiHS_NRG2
ExpressionAtlasiO14511 baseline and differential
GenevisibleiO14511 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR040180 Neuregulin
IPR002154 Neuregulin_C
PANTHERiPTHR11100 PTHR11100, 1 hit
PfamiView protein in Pfam
PF07679 I-set, 1 hit
PF02158 Neuregulin, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00408 IGc2, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS50835 IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRG2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O14511
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: January 1, 1998
Last modified: January 16, 2019
This is version 165 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again