Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large-associated protein 1

Gene

DLGAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Part of the postsynaptic scaffold in neuronal cells.

GO - Molecular functioni

GO - Biological processi

  • chemical synaptic transmission Source: ProtInc

Enzyme and pathway databases

ReactomeiR-HSA-6794361 Neurexins and neuroligins

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large-associated protein 1
Short name:
DAP-1
Alternative name(s):
Guanylate kinase-associated protein
Short name:
hGKAP
PSD-95/SAP90-binding protein 1
SAP90/PSD-95-associated protein 1
Short name:
SAPAP1
Gene namesi
Name:DLGAP1
Synonyms:DAP1, GKAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

EuPathDBiHostDB:ENSG00000170579.14
HGNCiHGNC:2905 DLGAP1
MIMi605445 gene
neXtProtiNX_O14490

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi9229
OpenTargetsiENSG00000170579
PharmGKBiPA27361

Polymorphism and mutation databases

BioMutaiDLGAP1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001742881 – 977Disks large-associated protein 1Add BLAST977

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei169PhosphoserineBy similarity1
Modified residuei356PhosphoserineBy similarity1
Modified residuei359PhosphoserineBy similarity1
Modified residuei362PhosphoserineBy similarity1
Modified residuei366PhosphoserineBy similarity1
Modified residuei383PhosphoserineBy similarity1
Modified residuei412PhosphoserineBy similarity1
Modified residuei415PhosphoserineBy similarity1
Modified residuei419PhosphoserineBy similarity1
Modified residuei422PhosphoserineBy similarity1
Modified residuei431PhosphoserineBy similarity1
Modified residuei503PhosphoserineBy similarity1
Modified residuei510PhosphoserineBy similarity1
Modified residuei562PhosphoserineBy similarity1
Modified residuei563PhosphothreonineBy similarity1
Modified residuei565PhosphoserineBy similarity1
Modified residuei589PhosphoserineBy similarity1
Modified residuei590PhosphothreonineBy similarity1
Modified residuei592PhosphoserineBy similarity1
Modified residuei595PhosphoserineBy similarity1
Modified residuei932PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO14490
PaxDbiO14490
PeptideAtlasiO14490
PRIDEiO14490
ProteomicsDBi48028
48029 [O14490-2]
48030 [O14490-3]
48031 [O14490-4]
48032 [O14490-5]
48033 [O14490-6]
48034 [O14490-7]

PTM databases

iPTMnetiO14490
PhosphoSitePlusiO14490

Expressioni

Tissue specificityi

Expressed in brain.

Gene expression databases

BgeeiENSG00000170579 Expressed in 159 organ(s), highest expression level in frontal cortex
CleanExiHS_DLGAP1
ExpressionAtlasiO14490 baseline and differential
GenevisibleiO14490 HS

Interactioni

Subunit structurei

Interacts with guanylate kinase-like domain of DLG1, DLG2, DLG3, DLG4 and AIP1. Interacts with the PDZ domain of SHANK1, SHANK2 and SHANK3. Found in a complex with DLG4 and SHANK1, SHANK2 or SHANK3. Found in a complex with DLG4 and BEGAIN. Interacts with DYL2 and LRFN1 (By similarity). Interacts with MPP2 (via the SH3-Guanylate kinase-like sub-module) (By similarity).By similarity

Binary interactionsi

Protein-protein interaction databases

BioGridi114660, 17 interactors
CORUMiO14490
IntActiO14490, 12 interactors
MINTiO14490
STRINGi9606.ENSP00000316377

Structurei

Secondary structure

1977
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO14490
SMRiO14490
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni650 – 661Interaction with DYL2By similarityAdd BLAST12
Regioni672 – 683Interaction with DYL2By similarityAdd BLAST12

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi975 – 977PDZ-bindingBy similarity3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi622 – 630Poly-Thr9

Sequence similaritiesi

Belongs to the SAPAP family.Curated

Phylogenomic databases

eggNOGiKOG3971 Eukaryota
ENOG4111JKV LUCA
GeneTreeiENSGT00550000074473
HOGENOMiHOG000015346
HOVERGENiHBG018957
InParanoidiO14490
KOiK15008
OMAiHYHACAV
OrthoDBiEOG091G0J9O
PhylomeDBiO14490
TreeFamiTF321382

Family and domain databases

InterProiView protein in InterPro
IPR030524 DLGAP1
IPR005026 SAPAP
PANTHERiPTHR12353 PTHR12353, 1 hit
PTHR12353:SF7 PTHR12353:SF7, 1 hit
PfamiView protein in Pfam
PF03359 GKAP, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O14490-1) [UniParc]FASTAAdd to basket
Also known as: DAP1-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKGLSGSRSH HHGVTCDSAC DSLSHHSDRK PYLLSPVEHH PADHPYYTQR
60 70 80 90 100
NSFQAECVGP FSDPLASSTF PRRHYTSQQE LKDECALVPR TLATKANRIP
110 120 130 140 150
ANLLDQFERQ LPLSRDGYHT LQYKRTAVEH RSDSPGRIRH LVHSVQKLFT
160 170 180 190 200
KSHSLEGPSK GSVNGGKASP DEAQAARYGK RSKSKERRAE PKARPSTSPG
210 220 230 240 250
WWSSDDNLDG DMCIYHAPSG VMTMGRCPDR SASQYFLEAY NTISEQAVKA
260 270 280 290 300
SRSNNDVKCS TCANLPVSLD TPLLKKSAWS STLTVSRARE VYQKASVNMD
310 320 330 340 350
QAMVKSESCQ QERSCQYLQV PQDEWTGYTP RGKDDEIPCR RMRSGSYIKA
360 370 380 390 400
MGDEDSGDSD TSPKPSPKVA ARRESYLKAT QPSLTELTTL KISNEHSPKL
410 420 430 440 450
QIRSHSYLRA VSEVSINRSL DSLDPAGLLT SPKFRSRNES YMRAMSTISQ
460 470 480 490 500
VSEMEVNGQF ESVCESVFSE LESQAVEALD LPMPGCFRMR SHSYVRAIEK
510 520 530 540 550
GCSQDDECVS LRSSSPPRTT TTVRTIQSST VSSCITTYKK TPPPVPPRTT
560 570 580 590 600
TKPFISITAQ SSTESAQDAY MDGQGQRGDI ISQSGLSNST ESLDSMKALT
610 620 630 640 650
AAIEAANAQI HGPASQHMGN NTATVTTTTT IATVTTEDRK KDHFKKNRCL
660 670 680 690 700
SIGIQVDDAE EPDKTGENKA PSKFQSVGVQ VEEEKCFRRF TRSNSVTTAV
710 720 730 740 750
QADLDFHDNL ENSLESIEDN SCPGPMARQF SRDASTSTVS IQGSGNHYHA
760 770 780 790 800
CAADDDFDTD FDPSILPPPD PWIDSITEDP LEAVQRSVCH RDGHWFLKLL
810 820 830 840 850
QAERDRMEGW CQQMEREERE NNLPEDILGK IRTAVGSAQL LMAQKFYQFR
860 870 880 890 900
ELCEENLNPN AHPRPTSQDL AGFWDMLQLS IENISMKFDE LHQLKANNWK
910 920 930 940 950
QMDPLDKKER RAPPPVPKKP AKGPAPLIRE RSLESSQRQE ARKRLMAAKR
960 970
AASVRQNSAT ESAESIEIYI PEAQTRL
Length:977
Mass (Da):108,873
Last modified:January 1, 1998 - v1
Checksum:i670F72B17D9BE667
GO
Isoform 2 (identifier: O14490-2) [UniParc]FASTAAdd to basket
Also known as: DAP1-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-302: Missing.
     303-319: MVKSESCQQERSCQYLQ → MNLIFHKDILFGIPANK

Show »
Length:675
Mass (Da):75,261
Checksum:iA88274F7F3D9F5ED
GO
Isoform 3 (identifier: O14490-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-302: Missing.
     303-319: MVKSESCQQERSCQYLQ → MNLIFHKDILFGIPANK
     909-929: ERRAPPPVPKKPAKGPAPLIR → VEQCRFCMVHLKTCTNTGQSK
     930-977: Missing.

Show »
Length:627
Mass (Da):69,969
Checksum:i2326123341316726
GO
Isoform 4 (identifier: O14490-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MKGLSGSRSHHHGVTCDSACDSLS → MIDLFKAEWVSSVCVQVSRNGRTD
     25-318: Missing.

Note: No experimental confirmation available.
Show »
Length:683
Mass (Da):76,159
Checksum:i8F23FC02956683BE
GO
Isoform 5 (identifier: O14490-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MKGLSGSRSHHHGVTCDSACDSLSHHSDRKP → MDLKTLKLFNSQLRCGWLLYIWNKAFMAHLR
     32-319: Missing.
     530-557: Missing.

Note: No experimental confirmation available.
Show »
Length:661
Mass (Da):74,058
Checksum:i5A96B64BA7D70469
GO
Isoform 6 (identifier: O14490-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MKGLSGSRSHHHGVTCD → MNLIFHKDILFGIPANK
     18-31: Missing.
     32-319: Missing.
     530-530: T → TGVIKLSSAVE

Note: No experimental confirmation available.
Show »
Length:685
Mass (Da):76,245
Checksum:iACBD1D7BB4CC8756
GO
Isoform 7 (identifier: O14490-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     909-929: ERRAPPPVPKKPAKGPAPLIR → VEQCRFCMVHLKTCTNTGQSK
     930-977: Missing.

Note: No experimental confirmation available.
Show »
Length:929
Mass (Da):103,581
Checksum:i00E65FE3F36B7D6B
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8MXQ8A8MXQ8_HUMAN
Discs, large (Drosophila) homolog-a...
DLGAP1 hCG_38077
693Annotation score:
A0A0A0MTP4A0A0A0MTP4_HUMAN
Disks large-associated protein 1
DLGAP1
699Annotation score:
A8MYR7A8MYR7_HUMAN
Discs, large (Drosophila) homolog-a...
DLGAP1 hCG_38077
667Annotation score:
Q6IS01Q6IS01_HUMAN
DLGAP1 protein
DLGAP1 hCG_38077
543Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti734A → P in AAC51119 (PubMed:9024696).Curated1
Sequence conflicti740S → T in AAC51119 (PubMed:9024696).Curated1
Sequence conflicti752 – 753AA → SP in AAC51119 (PubMed:9024696).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053648816R → Q. Corresponds to variant dbSNP:rs35822832Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0060031 – 302Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST302
Alternative sequenceiVSP_0437181 – 31MKGLS…SDRKP → MDLKTLKLFNSQLRCGWLLY IWNKAFMAHLR in isoform 5. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_0432221 – 24MKGLS…CDSLS → MIDLFKAEWVSSVCVQVSRN GRTD in isoform 4. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_0437191 – 17MKGLS…GVTCD → MNLIFHKDILFGIPANK in isoform 6. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_04372018 – 31Missing in isoform 6. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_04322325 – 318Missing in isoform 4. 1 PublicationAdd BLAST294
Alternative sequenceiVSP_04372132 – 319Missing in isoform 5 and isoform 6. 1 PublicationAdd BLAST288
Alternative sequenceiVSP_006004303 – 319MVKSE…CQYLQ → MNLIFHKDILFGIPANK in isoform 2 and isoform 3. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_043722530 – 557Missing in isoform 5. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_043723530T → TGVIKLSSAVE in isoform 6. 1 Publication1
Alternative sequenceiVSP_006005909 – 929ERRAP…APLIR → VEQCRFCMVHLKTCTNTGQS K in isoform 3 and isoform 7. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_006006930 – 977Missing in isoform 3 and isoform 7. 2 PublicationsAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000277 mRNA Translation: BAA23258.1
AB000276 mRNA Translation: BAA23257.1
U67988 mRNA Translation: AAC51119.1
AK294717 mRNA Translation: BAH11858.1
AK294747 mRNA Translation: BAH11868.1
AK299880 mRNA Translation: BAH13160.1
AK316099 mRNA Translation: BAH14470.1
AP002472 Genomic DNA No translation available.
AP002478 Genomic DNA No translation available.
AP005130 Genomic DNA No translation available.
AP005204 Genomic DNA No translation available.
AP005241 Genomic DNA No translation available.
CH471113 Genomic DNA Translation: EAX01654.1
CH471113 Genomic DNA Translation: EAX01658.1
CH471113 Genomic DNA Translation: EAX01659.1
BC136453 mRNA Translation: AAI36454.1
BC136454 mRNA Translation: AAI36455.1
CCDSiCCDS11836.1 [O14490-1]
CCDS42406.1 [O14490-2]
CCDS56049.1 [O14490-3]
CCDS56050.1 [O14490-6]
CCDS56051.1 [O14490-4]
CCDS56052.1 [O14490-5]
CCDS56053.1 [O14490-7]
PIRiT00014
RefSeqiNP_001003809.1, NM_001003809.2 [O14490-2]
NP_001229690.1, NM_001242761.1 [O14490-7]
NP_001229691.1, NM_001242762.1 [O14490-5]
NP_001229692.1, NM_001242763.1
NP_001229693.1, NM_001242764.1 [O14490-4]
NP_001229694.1, NM_001242765.1 [O14490-3]
NP_001229695.1, NM_001242766.1 [O14490-6]
NP_004737.2, NM_004746.3 [O14490-1]
UniGeneiHs.594640
Hs.654793
Hs.673247

Genome annotation databases

EnsembliENST00000315677; ENSP00000316377; ENSG00000170579 [O14490-1]
ENST00000400145; ENSP00000383010; ENSG00000170579 [O14490-3]
ENST00000400147; ENSP00000383011; ENSG00000170579 [O14490-2]
ENST00000400155; ENSP00000383019; ENSG00000170579 [O14490-4]
ENST00000534970; ENSP00000437817; ENSG00000170579 [O14490-5]
ENST00000539435; ENSP00000446312; ENSG00000170579 [O14490-6]
ENST00000581527; ENSP00000463864; ENSG00000170579 [O14490-7]
ENST00000581699; ENSP00000462848; ENSG00000170579 [O14490-4]
GeneIDi9229
KEGGihsa:9229
UCSCiuc002kme.3 human [O14490-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000277 mRNA Translation: BAA23258.1
AB000276 mRNA Translation: BAA23257.1
U67988 mRNA Translation: AAC51119.1
AK294717 mRNA Translation: BAH11858.1
AK294747 mRNA Translation: BAH11868.1
AK299880 mRNA Translation: BAH13160.1
AK316099 mRNA Translation: BAH14470.1
AP002472 Genomic DNA No translation available.
AP002478 Genomic DNA No translation available.
AP005130 Genomic DNA No translation available.
AP005204 Genomic DNA No translation available.
AP005241 Genomic DNA No translation available.
CH471113 Genomic DNA Translation: EAX01654.1
CH471113 Genomic DNA Translation: EAX01658.1
CH471113 Genomic DNA Translation: EAX01659.1
BC136453 mRNA Translation: AAI36454.1
BC136454 mRNA Translation: AAI36455.1
CCDSiCCDS11836.1 [O14490-1]
CCDS42406.1 [O14490-2]
CCDS56049.1 [O14490-3]
CCDS56050.1 [O14490-6]
CCDS56051.1 [O14490-4]
CCDS56052.1 [O14490-5]
CCDS56053.1 [O14490-7]
PIRiT00014
RefSeqiNP_001003809.1, NM_001003809.2 [O14490-2]
NP_001229690.1, NM_001242761.1 [O14490-7]
NP_001229691.1, NM_001242762.1 [O14490-5]
NP_001229692.1, NM_001242763.1
NP_001229693.1, NM_001242764.1 [O14490-4]
NP_001229694.1, NM_001242765.1 [O14490-3]
NP_001229695.1, NM_001242766.1 [O14490-6]
NP_004737.2, NM_004746.3 [O14490-1]
UniGeneiHs.594640
Hs.654793
Hs.673247

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5YPOX-ray2.29C/D370-384[»]
ProteinModelPortaliO14490
SMRiO14490
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114660, 17 interactors
CORUMiO14490
IntActiO14490, 12 interactors
MINTiO14490
STRINGi9606.ENSP00000316377

PTM databases

iPTMnetiO14490
PhosphoSitePlusiO14490

Polymorphism and mutation databases

BioMutaiDLGAP1

Proteomic databases

EPDiO14490
PaxDbiO14490
PeptideAtlasiO14490
PRIDEiO14490
ProteomicsDBi48028
48029 [O14490-2]
48030 [O14490-3]
48031 [O14490-4]
48032 [O14490-5]
48033 [O14490-6]
48034 [O14490-7]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000315677; ENSP00000316377; ENSG00000170579 [O14490-1]
ENST00000400145; ENSP00000383010; ENSG00000170579 [O14490-3]
ENST00000400147; ENSP00000383011; ENSG00000170579 [O14490-2]
ENST00000400155; ENSP00000383019; ENSG00000170579 [O14490-4]
ENST00000534970; ENSP00000437817; ENSG00000170579 [O14490-5]
ENST00000539435; ENSP00000446312; ENSG00000170579 [O14490-6]
ENST00000581527; ENSP00000463864; ENSG00000170579 [O14490-7]
ENST00000581699; ENSP00000462848; ENSG00000170579 [O14490-4]
GeneIDi9229
KEGGihsa:9229
UCSCiuc002kme.3 human [O14490-1]

Organism-specific databases

CTDi9229
DisGeNETi9229
EuPathDBiHostDB:ENSG00000170579.14
GeneCardsiDLGAP1
HGNCiHGNC:2905 DLGAP1
MIMi605445 gene
neXtProtiNX_O14490
OpenTargetsiENSG00000170579
PharmGKBiPA27361
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3971 Eukaryota
ENOG4111JKV LUCA
GeneTreeiENSGT00550000074473
HOGENOMiHOG000015346
HOVERGENiHBG018957
InParanoidiO14490
KOiK15008
OMAiHYHACAV
OrthoDBiEOG091G0J9O
PhylomeDBiO14490
TreeFamiTF321382

Enzyme and pathway databases

ReactomeiR-HSA-6794361 Neurexins and neuroligins

Miscellaneous databases

ChiTaRSiDLGAP1 human
GeneWikiiDLGAP1
GenomeRNAii9229
PROiPR:O14490
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000170579 Expressed in 159 organ(s), highest expression level in frontal cortex
CleanExiHS_DLGAP1
ExpressionAtlasiO14490 baseline and differential
GenevisibleiO14490 HS

Family and domain databases

InterProiView protein in InterPro
IPR030524 DLGAP1
IPR005026 SAPAP
PANTHERiPTHR12353 PTHR12353, 1 hit
PTHR12353:SF7 PTHR12353:SF7, 1 hit
PfamiView protein in Pfam
PF03359 GKAP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDLGP1_HUMAN
AccessioniPrimary (citable) accession number: O14490
Secondary accession number(s): A8MWN8
, B2RMU8, B7WPA1, B7Z2H2, B7Z2I2, B7Z9Y4, O14489, P78335
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: January 1, 1998
Last modified: November 7, 2018
This is version 146 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again