Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large-associated protein 1

Gene

DLGAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Part of the postsynaptic scaffold in neuronal cells.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • chemical synaptic transmission Source: ProtInc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6794361 Neurexins and neuroligins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disks large-associated protein 1
Short name:
DAP-1
Alternative name(s):
Guanylate kinase-associated protein
Short name:
hGKAP
PSD-95/SAP90-binding protein 1
SAP90/PSD-95-associated protein 1
Short name:
SAPAP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DLGAP1
Synonyms:DAP1, GKAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000170579.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2905 DLGAP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605445 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O14490

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9229

Open Targets

More...
OpenTargetsi
ENSG00000170579

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27361

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DLGAP1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001742881 – 977Disks large-associated protein 1Add BLAST977

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei169PhosphoserineBy similarity1
Modified residuei356PhosphoserineBy similarity1
Modified residuei359PhosphoserineBy similarity1
Modified residuei362PhosphoserineBy similarity1
Modified residuei366PhosphoserineBy similarity1
Modified residuei383PhosphoserineBy similarity1
Modified residuei412PhosphoserineBy similarity1
Modified residuei415PhosphoserineBy similarity1
Modified residuei419PhosphoserineBy similarity1
Modified residuei422PhosphoserineBy similarity1
Modified residuei431PhosphoserineBy similarity1
Modified residuei503PhosphoserineBy similarity1
Modified residuei510PhosphoserineBy similarity1
Modified residuei562PhosphoserineBy similarity1
Modified residuei563PhosphothreonineBy similarity1
Modified residuei565PhosphoserineBy similarity1
Modified residuei589PhosphoserineBy similarity1
Modified residuei590PhosphothreonineBy similarity1
Modified residuei592PhosphoserineBy similarity1
Modified residuei595PhosphoserineBy similarity1
Modified residuei932PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O14490

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O14490

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O14490

PeptideAtlas

More...
PeptideAtlasi
O14490

PRoteomics IDEntifications database

More...
PRIDEi
O14490

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48028
48029 [O14490-2]
48030 [O14490-3]
48031 [O14490-4]
48032 [O14490-5]
48033 [O14490-6]
48034 [O14490-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O14490

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O14490

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000170579 Expressed in 159 organ(s), highest expression level in frontal cortex

CleanEx database of gene expression profiles

More...
CleanExi
HS_DLGAP1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O14490 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O14490 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with guanylate kinase-like domain of DLG1, DLG2, DLG3, DLG4 and AIP1. Interacts with the PDZ domain of SHANK1, SHANK2 and SHANK3. Found in a complex with DLG4 and SHANK1, SHANK2 or SHANK3. Found in a complex with DLG4 and BEGAIN. Interacts with DYL2 and LRFN1 (By similarity). Interacts with MPP2 (via the SH3-Guanylate kinase-like sub-module) (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114660, 17 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O14490

Protein interaction database and analysis system

More...
IntActi
O14490, 12 interactors

Molecular INTeraction database

More...
MINTi
O14490

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000316377

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1977
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5YPOX-ray2.29C/D370-384[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O14490

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O14490

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni650 – 661Interaction with DYL2By similarityAdd BLAST12
Regioni672 – 683Interaction with DYL2By similarityAdd BLAST12

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi975 – 977PDZ-bindingBy similarity3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi622 – 630Poly-Thr9

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SAPAP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3971 Eukaryota
ENOG4111JKV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156220

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015346

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG018957

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O14490

KEGG Orthology (KO)

More...
KOi
K15008

Identification of Orthologs from Complete Genome Data

More...
OMAi
HYHACAV

Database of Orthologous Groups

More...
OrthoDBi
285447at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O14490

TreeFam database of animal gene trees

More...
TreeFami
TF321382

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030524 DLGAP1
IPR005026 SAPAP

The PANTHER Classification System

More...
PANTHERi
PTHR12353 PTHR12353, 1 hit
PTHR12353:SF7 PTHR12353:SF7, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03359 GKAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O14490-1) [UniParc]FASTAAdd to basket
Also known as: DAP1-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKGLSGSRSH HHGVTCDSAC DSLSHHSDRK PYLLSPVEHH PADHPYYTQR
60 70 80 90 100
NSFQAECVGP FSDPLASSTF PRRHYTSQQE LKDECALVPR TLATKANRIP
110 120 130 140 150
ANLLDQFERQ LPLSRDGYHT LQYKRTAVEH RSDSPGRIRH LVHSVQKLFT
160 170 180 190 200
KSHSLEGPSK GSVNGGKASP DEAQAARYGK RSKSKERRAE PKARPSTSPG
210 220 230 240 250
WWSSDDNLDG DMCIYHAPSG VMTMGRCPDR SASQYFLEAY NTISEQAVKA
260 270 280 290 300
SRSNNDVKCS TCANLPVSLD TPLLKKSAWS STLTVSRARE VYQKASVNMD
310 320 330 340 350
QAMVKSESCQ QERSCQYLQV PQDEWTGYTP RGKDDEIPCR RMRSGSYIKA
360 370 380 390 400
MGDEDSGDSD TSPKPSPKVA ARRESYLKAT QPSLTELTTL KISNEHSPKL
410 420 430 440 450
QIRSHSYLRA VSEVSINRSL DSLDPAGLLT SPKFRSRNES YMRAMSTISQ
460 470 480 490 500
VSEMEVNGQF ESVCESVFSE LESQAVEALD LPMPGCFRMR SHSYVRAIEK
510 520 530 540 550
GCSQDDECVS LRSSSPPRTT TTVRTIQSST VSSCITTYKK TPPPVPPRTT
560 570 580 590 600
TKPFISITAQ SSTESAQDAY MDGQGQRGDI ISQSGLSNST ESLDSMKALT
610 620 630 640 650
AAIEAANAQI HGPASQHMGN NTATVTTTTT IATVTTEDRK KDHFKKNRCL
660 670 680 690 700
SIGIQVDDAE EPDKTGENKA PSKFQSVGVQ VEEEKCFRRF TRSNSVTTAV
710 720 730 740 750
QADLDFHDNL ENSLESIEDN SCPGPMARQF SRDASTSTVS IQGSGNHYHA
760 770 780 790 800
CAADDDFDTD FDPSILPPPD PWIDSITEDP LEAVQRSVCH RDGHWFLKLL
810 820 830 840 850
QAERDRMEGW CQQMEREERE NNLPEDILGK IRTAVGSAQL LMAQKFYQFR
860 870 880 890 900
ELCEENLNPN AHPRPTSQDL AGFWDMLQLS IENISMKFDE LHQLKANNWK
910 920 930 940 950
QMDPLDKKER RAPPPVPKKP AKGPAPLIRE RSLESSQRQE ARKRLMAAKR
960 970
AASVRQNSAT ESAESIEIYI PEAQTRL
Length:977
Mass (Da):108,873
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i670F72B17D9BE667
GO
Isoform 2 (identifier: O14490-2) [UniParc]FASTAAdd to basket
Also known as: DAP1-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-302: Missing.
     303-319: MVKSESCQQERSCQYLQ → MNLIFHKDILFGIPANK

Show »
Length:675
Mass (Da):75,261
Checksum:iA88274F7F3D9F5ED
GO
Isoform 3 (identifier: O14490-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-302: Missing.
     303-319: MVKSESCQQERSCQYLQ → MNLIFHKDILFGIPANK
     909-929: ERRAPPPVPKKPAKGPAPLIR → VEQCRFCMVHLKTCTNTGQSK
     930-977: Missing.

Show »
Length:627
Mass (Da):69,969
Checksum:i2326123341316726
GO
Isoform 4 (identifier: O14490-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MKGLSGSRSHHHGVTCDSACDSLS → MIDLFKAEWVSSVCVQVSRNGRTD
     25-318: Missing.

Note: No experimental confirmation available.
Show »
Length:683
Mass (Da):76,159
Checksum:i8F23FC02956683BE
GO
Isoform 5 (identifier: O14490-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MKGLSGSRSHHHGVTCDSACDSLSHHSDRKP → MDLKTLKLFNSQLRCGWLLYIWNKAFMAHLR
     32-319: Missing.
     530-557: Missing.

Note: No experimental confirmation available.
Show »
Length:661
Mass (Da):74,058
Checksum:i5A96B64BA7D70469
GO
Isoform 6 (identifier: O14490-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MKGLSGSRSHHHGVTCD → MNLIFHKDILFGIPANK
     18-31: Missing.
     32-319: Missing.
     530-530: T → TGVIKLSSAVE

Note: No experimental confirmation available.
Show »
Length:685
Mass (Da):76,245
Checksum:iACBD1D7BB4CC8756
GO
Isoform 7 (identifier: O14490-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     909-929: ERRAPPPVPKKPAKGPAPLIR → VEQCRFCMVHLKTCTNTGQSK
     930-977: Missing.

Note: No experimental confirmation available.
Show »
Length:929
Mass (Da):103,581
Checksum:i00E65FE3F36B7D6B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8MXQ8A8MXQ8_HUMAN
Discs, large (Drosophila) homolog-a...
DLGAP1 hCG_38077
693Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MTP4A0A0A0MTP4_HUMAN
Disks large-associated protein 1
DLGAP1
699Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8MYR7A8MYR7_HUMAN
Discs, large (Drosophila) homolog-a...
DLGAP1 hCG_38077
667Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6IS01Q6IS01_HUMAN
DLGAP1 protein
DLGAP1 hCG_38077
543Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti734A → P in AAC51119 (PubMed:9024696).Curated1
Sequence conflicti740S → T in AAC51119 (PubMed:9024696).Curated1
Sequence conflicti752 – 753AA → SP in AAC51119 (PubMed:9024696).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053648816R → Q. Corresponds to variant dbSNP:rs35822832Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0060031 – 302Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST302
Alternative sequenceiVSP_0437181 – 31MKGLS…SDRKP → MDLKTLKLFNSQLRCGWLLY IWNKAFMAHLR in isoform 5. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_0432221 – 24MKGLS…CDSLS → MIDLFKAEWVSSVCVQVSRN GRTD in isoform 4. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_0437191 – 17MKGLS…GVTCD → MNLIFHKDILFGIPANK in isoform 6. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_04372018 – 31Missing in isoform 6. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_04322325 – 318Missing in isoform 4. 1 PublicationAdd BLAST294
Alternative sequenceiVSP_04372132 – 319Missing in isoform 5 and isoform 6. 1 PublicationAdd BLAST288
Alternative sequenceiVSP_006004303 – 319MVKSE…CQYLQ → MNLIFHKDILFGIPANK in isoform 2 and isoform 3. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_043722530 – 557Missing in isoform 5. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_043723530T → TGVIKLSSAVE in isoform 6. 1 Publication1
Alternative sequenceiVSP_006005909 – 929ERRAP…APLIR → VEQCRFCMVHLKTCTNTGQS K in isoform 3 and isoform 7. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_006006930 – 977Missing in isoform 3 and isoform 7. 2 PublicationsAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB000277 mRNA Translation: BAA23258.1
AB000276 mRNA Translation: BAA23257.1
U67988 mRNA Translation: AAC51119.1
AK294717 mRNA Translation: BAH11858.1
AK294747 mRNA Translation: BAH11868.1
AK299880 mRNA Translation: BAH13160.1
AK316099 mRNA Translation: BAH14470.1
AP002472 Genomic DNA No translation available.
AP002478 Genomic DNA No translation available.
AP005130 Genomic DNA No translation available.
AP005204 Genomic DNA No translation available.
AP005241 Genomic DNA No translation available.
CH471113 Genomic DNA Translation: EAX01654.1
CH471113 Genomic DNA Translation: EAX01658.1
CH471113 Genomic DNA Translation: EAX01659.1
BC136453 mRNA Translation: AAI36454.1
BC136454 mRNA Translation: AAI36455.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11836.1 [O14490-1]
CCDS42406.1 [O14490-2]
CCDS56049.1 [O14490-3]
CCDS56050.1 [O14490-6]
CCDS56051.1 [O14490-4]
CCDS56052.1 [O14490-5]
CCDS56053.1 [O14490-7]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00014

NCBI Reference Sequences

More...
RefSeqi
NP_001003809.1, NM_001003809.2 [O14490-2]
NP_001229690.1, NM_001242761.1 [O14490-7]
NP_001229691.1, NM_001242762.1 [O14490-5]
NP_001229692.1, NM_001242763.1
NP_001229693.1, NM_001242764.1 [O14490-4]
NP_001229694.1, NM_001242765.1 [O14490-3]
NP_001229695.1, NM_001242766.1 [O14490-6]
NP_004737.2, NM_004746.3 [O14490-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.594640
Hs.654793
Hs.673247

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000315677; ENSP00000316377; ENSG00000170579 [O14490-1]
ENST00000400145; ENSP00000383010; ENSG00000170579 [O14490-3]
ENST00000400147; ENSP00000383011; ENSG00000170579 [O14490-2]
ENST00000400155; ENSP00000383019; ENSG00000170579 [O14490-4]
ENST00000534970; ENSP00000437817; ENSG00000170579 [O14490-5]
ENST00000539435; ENSP00000446312; ENSG00000170579 [O14490-6]
ENST00000581527; ENSP00000463864; ENSG00000170579 [O14490-7]
ENST00000581699; ENSP00000462848; ENSG00000170579 [O14490-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9229

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9229

UCSC genome browser

More...
UCSCi
uc002kme.3 human [O14490-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000277 mRNA Translation: BAA23258.1
AB000276 mRNA Translation: BAA23257.1
U67988 mRNA Translation: AAC51119.1
AK294717 mRNA Translation: BAH11858.1
AK294747 mRNA Translation: BAH11868.1
AK299880 mRNA Translation: BAH13160.1
AK316099 mRNA Translation: BAH14470.1
AP002472 Genomic DNA No translation available.
AP002478 Genomic DNA No translation available.
AP005130 Genomic DNA No translation available.
AP005204 Genomic DNA No translation available.
AP005241 Genomic DNA No translation available.
CH471113 Genomic DNA Translation: EAX01654.1
CH471113 Genomic DNA Translation: EAX01658.1
CH471113 Genomic DNA Translation: EAX01659.1
BC136453 mRNA Translation: AAI36454.1
BC136454 mRNA Translation: AAI36455.1
CCDSiCCDS11836.1 [O14490-1]
CCDS42406.1 [O14490-2]
CCDS56049.1 [O14490-3]
CCDS56050.1 [O14490-6]
CCDS56051.1 [O14490-4]
CCDS56052.1 [O14490-5]
CCDS56053.1 [O14490-7]
PIRiT00014
RefSeqiNP_001003809.1, NM_001003809.2 [O14490-2]
NP_001229690.1, NM_001242761.1 [O14490-7]
NP_001229691.1, NM_001242762.1 [O14490-5]
NP_001229692.1, NM_001242763.1
NP_001229693.1, NM_001242764.1 [O14490-4]
NP_001229694.1, NM_001242765.1 [O14490-3]
NP_001229695.1, NM_001242766.1 [O14490-6]
NP_004737.2, NM_004746.3 [O14490-1]
UniGeneiHs.594640
Hs.654793
Hs.673247

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5YPOX-ray2.29C/D370-384[»]
ProteinModelPortaliO14490
SMRiO14490
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114660, 17 interactors
CORUMiO14490
IntActiO14490, 12 interactors
MINTiO14490
STRINGi9606.ENSP00000316377

PTM databases

iPTMnetiO14490
PhosphoSitePlusiO14490

Polymorphism and mutation databases

BioMutaiDLGAP1

Proteomic databases

EPDiO14490
jPOSTiO14490
PaxDbiO14490
PeptideAtlasiO14490
PRIDEiO14490
ProteomicsDBi48028
48029 [O14490-2]
48030 [O14490-3]
48031 [O14490-4]
48032 [O14490-5]
48033 [O14490-6]
48034 [O14490-7]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000315677; ENSP00000316377; ENSG00000170579 [O14490-1]
ENST00000400145; ENSP00000383010; ENSG00000170579 [O14490-3]
ENST00000400147; ENSP00000383011; ENSG00000170579 [O14490-2]
ENST00000400155; ENSP00000383019; ENSG00000170579 [O14490-4]
ENST00000534970; ENSP00000437817; ENSG00000170579 [O14490-5]
ENST00000539435; ENSP00000446312; ENSG00000170579 [O14490-6]
ENST00000581527; ENSP00000463864; ENSG00000170579 [O14490-7]
ENST00000581699; ENSP00000462848; ENSG00000170579 [O14490-4]
GeneIDi9229
KEGGihsa:9229
UCSCiuc002kme.3 human [O14490-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9229
DisGeNETi9229
EuPathDBiHostDB:ENSG00000170579.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DLGAP1
HGNCiHGNC:2905 DLGAP1
MIMi605445 gene
neXtProtiNX_O14490
OpenTargetsiENSG00000170579
PharmGKBiPA27361

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3971 Eukaryota
ENOG4111JKV LUCA
GeneTreeiENSGT00940000156220
HOGENOMiHOG000015346
HOVERGENiHBG018957
InParanoidiO14490
KOiK15008
OMAiHYHACAV
OrthoDBi285447at2759
PhylomeDBiO14490
TreeFamiTF321382

Enzyme and pathway databases

ReactomeiR-HSA-6794361 Neurexins and neuroligins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DLGAP1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DLGAP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9229

Protein Ontology

More...
PROi
PR:O14490

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000170579 Expressed in 159 organ(s), highest expression level in frontal cortex
CleanExiHS_DLGAP1
ExpressionAtlasiO14490 baseline and differential
GenevisibleiO14490 HS

Family and domain databases

InterProiView protein in InterPro
IPR030524 DLGAP1
IPR005026 SAPAP
PANTHERiPTHR12353 PTHR12353, 1 hit
PTHR12353:SF7 PTHR12353:SF7, 1 hit
PfamiView protein in Pfam
PF03359 GKAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDLGP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O14490
Secondary accession number(s): A8MWN8
, B2RMU8, B7WPA1, B7Z2H2, B7Z2I2, B7Z9Y4, O14489, P78335
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: January 1, 1998
Last modified: January 16, 2019
This is version 148 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again