Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity mitogen-activated protein kinase kinase 3

Gene

Map2k3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14.By similarity

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.By similarity

Activity regulationi

Activated by dual phosphorylation on Ser-218 and Thr-222.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei93ATPPROSITE-ProRule annotation1
Active sitei190Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi70 – 78ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • MAP kinase kinase activity Source: MGI
  • protein kinase binding Source: UniProtKB
  • protein serine/threonine kinase activity Source: GO_Central
  • protein tyrosine kinase activity Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase, Tyrosine-protein kinase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.12.2 3474
ReactomeiR-MMU-2559580 Oxidative Stress Induced Senescence
R-MMU-450302 activated TAK1 mediates p38 MAPK activation

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity mitogen-activated protein kinase kinase 3 (EC:2.7.12.2By similarity)
Short name:
MAP kinase kinase 3
Short name:
MAPKK 3
Alternative name(s):
MAPK/ERK kinase 3
Short name:
MEK 3
Gene namesi
Name:Map2k3
Synonyms:Mkk3, Prkmk3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1346868 Map2k3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL3721303

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000863791 – 347Dual specificity mitogen-activated protein kinase kinase 3Add BLAST347

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei3PhosphoserineBy similarity1
Modified residuei218PhosphoserineBy similarity1
Modified residuei222PhosphothreonineBy similarity1

Post-translational modificationi

Autophosphorylated. Phosphorylation on Ser-218 and Thr-222 by MAP kinase kinase kinases regulates positively the kinase activity. Phosphorylated by TAOK2.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO09110
PaxDbiO09110
PeptideAtlasiO09110
PRIDEiO09110

PTM databases

iPTMnetiO09110
PhosphoSitePlusiO09110

Expressioni

Gene expression databases

BgeeiENSMUSG00000018932 Expressed in 281 organ(s), highest expression level in blood
CleanExiMM_MAP2K3
ExpressionAtlasiO09110 baseline and differential
GenevisibleiO09110 MM

Interactioni

Subunit structurei

Component of a signaling complex containing at least AKAP13, PKN1, MAPK14, ZAK and MAP2K3. Within this complex, AKAP13 interacts directly with PKN1, which in turn recruits MAPK14, MAP2K3 and ZAK. Binds to DYRK1B/MIRK and increases its kinase activity (By similarity). Part of a complex with MAP3K3, RAC1 and CCM2 (PubMed:14634666). Interacts with ARRB1 (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204951, 8 interactors
IntActiO09110, 4 interactors
MINTiO09110
STRINGi10090.ENSMUSP00000019076

Structurei

3D structure databases

ProteinModelPortaliO09110
SMRiO09110
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini64 – 325Protein kinasePROSITE-ProRule annotationAdd BLAST262

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0984 Eukaryota
ENOG410XT3F LUCA
GeneTreeiENSGT00760000119199
HOGENOMiHOG000234206
HOVERGENiHBG108518
InParanoidiO09110
KOiK04432
OMAiACVTIGD
OrthoDBiEOG091G0A9H
PhylomeDBiO09110
TreeFamiTF350701

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 2 (identifier: O09110-1) [UniParc]FASTAAdd to basket
Also known as: 3b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESPAASPPA SLPQTKGKSK RKKDLRISCV SKPPVSNPTP PRNLDSRTFI
60 70 80 90 100
TIGDRNFEVE ADDLVTISEL GRGAYGVVEK VRHAQSGTIM AVKRIRATVN
110 120 130 140 150
TQEQKRLLMD LDINMRTVDC FYTVTFYGAL FREGDVWICM ELMDTSLDKF
160 170 180 190 200
YRKVLEKNMK IPEDILGEIA VSIVRALEHL HSKLSVIHRD VKPSNVLINK
210 220 230 240 250
EGHVKMCDFG ISGYLVDSVA KTMDAGCKPY MAPERINPEL NQKGYNVKSD
260 270 280 290 300
VWSLGITMIE MAILRFPYES WGTPFQQLKQ VVEEPSPQLP ADQFSPEFVD
310 320 330 340
FTSQCLRKNP AERMSYLELM EHPFFTLHKT KKTDIAAFVK EILGEDS
Length:347
Mass (Da):39,296
Last modified:November 1, 2002 - v2
Checksum:i4A2A420EDCA8A2BC
GO
Isoform 1 (identifier: O09110-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSN → MSKP

Show »
Length:314
Mass (Da):35,836
Checksum:i3F85122E7F272D5B
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0R4J1Q6A0A0R4J1Q6_MOUSE
Dual-specificity mitogen-activated ...
Map2k3
173Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti39T → A (Ref. 1) Curated1
Sequence conflicti60E → K in CAA63649 (Ref. 1) Curated1
Sequence conflicti173 – 347IVRAL…LGEDS → M (PubMed:15489334).CuratedAdd BLAST175
Sequence conflicti216V → E in CAA63649 (Ref. 1) Curated1
Sequence conflicti292D → Y in CAA63649 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0048791 – 37MESPA…PPVSN → MSKP in isoform 1. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93150 mRNA Translation: CAA63649.1
D87115 mRNA Translation: BAA13247.1
AK011002 mRNA Translation: BAB27321.1
AK008141 mRNA Translation: BAB25489.1
BC007467 mRNA Translation: AAH07467.1
CCDSiCCDS24804.1 [O09110-1]
RefSeqiNP_032954.1, NM_008928.4 [O09110-1]
UniGeneiMm.18494

Genome annotation databases

EnsembliENSMUST00000019076; ENSMUSP00000019076; ENSMUSG00000018932 [O09110-1]
GeneIDi26397
KEGGimmu:26397
UCSCiuc007jgw.1 mouse [O09110-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93150 mRNA Translation: CAA63649.1
D87115 mRNA Translation: BAA13247.1
AK011002 mRNA Translation: BAB27321.1
AK008141 mRNA Translation: BAB25489.1
BC007467 mRNA Translation: AAH07467.1
CCDSiCCDS24804.1 [O09110-1]
RefSeqiNP_032954.1, NM_008928.4 [O09110-1]
UniGeneiMm.18494

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LEZX-ray2.30B16-32[»]
ProteinModelPortaliO09110
SMRiO09110
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204951, 8 interactors
IntActiO09110, 4 interactors
MINTiO09110
STRINGi10090.ENSMUSP00000019076

Chemistry databases

ChEMBLiCHEMBL3721303

PTM databases

iPTMnetiO09110
PhosphoSitePlusiO09110

Proteomic databases

EPDiO09110
PaxDbiO09110
PeptideAtlasiO09110
PRIDEiO09110

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000019076; ENSMUSP00000019076; ENSMUSG00000018932 [O09110-1]
GeneIDi26397
KEGGimmu:26397
UCSCiuc007jgw.1 mouse [O09110-1]

Organism-specific databases

CTDi5606
MGIiMGI:1346868 Map2k3

Phylogenomic databases

eggNOGiKOG0984 Eukaryota
ENOG410XT3F LUCA
GeneTreeiENSGT00760000119199
HOGENOMiHOG000234206
HOVERGENiHBG108518
InParanoidiO09110
KOiK04432
OMAiACVTIGD
OrthoDBiEOG091G0A9H
PhylomeDBiO09110
TreeFamiTF350701

Enzyme and pathway databases

BRENDAi2.7.12.2 3474
ReactomeiR-MMU-2559580 Oxidative Stress Induced Senescence
R-MMU-450302 activated TAK1 mediates p38 MAPK activation

Miscellaneous databases

PROiPR:O09110
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000018932 Expressed in 281 organ(s), highest expression level in blood
CleanExiMM_MAP2K3
ExpressionAtlasiO09110 baseline and differential
GenevisibleiO09110 MM

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMP2K3_MOUSE
AccessioniPrimary (citable) accession number: O09110
Secondary accession number(s): P97293, Q91VX1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 2002
Last modified: November 7, 2018
This is version 169 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again