Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 168 (13 Feb 2019)
Sequence version 4 (27 Jul 2011)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

A-kinase anchor protein 1, mitochondrial

Gene

Akap1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A. Anchors them to the cytoplasmic face of the mitochondrial outer membrane or allows them to reside in the endoplasmic reticulum. Does not contain the classic KDEL endoplasmic reticulum-targeting sequence. This explains how it is able to switch its localization, either being in the endoplasmic reticulum or in the mitochondria depending on which N-terminal part begins the isoform. The longest N-terminal part only present in isoform 2 and isoform 4 acts as a suppressor of mitochondrial targeting and as an activator of recessive endoplasmic reticulum targeting motif.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-983231 Factors involved in megakaryocyte development and platelet production

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
A-kinase anchor protein 1, mitochondrial
Alternative name(s):
Dual specificity A-kinase-anchoring protein 1
Short name:
D-AKAP-1
Protein kinase A-anchoring protein 1
Short name:
PRKA1
Spermatid A-kinase anchor protein
Short name:
S-AKAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Akap1
Synonyms:Akap
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:104729 Akap1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion, Mitochondrion outer membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 29MitochondrionBy similarityAdd BLAST29
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001666030 – 857A-kinase anchor protein 1, mitochondrialAdd BLAST828

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei55PhosphoserineCombined sources1
Modified residuei101PhosphoserineCombined sources1
Modified residuei103PhosphoserineCombined sources1
Modified residuei164PhosphoserineBy similarity1
Modified residuei401PhosphothreonineBy similarity1
Modified residuei487PhosphothreonineBy similarity1
Modified residuei527PhosphoserineBy similarity1
Modified residuei546PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O08715

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O08715

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O08715

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O08715

PeptideAtlas

More...
PeptideAtlasi
O08715

PRoteomics IDEntifications database

More...
PRIDEi
O08715

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O08715

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O08715

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O08715

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest expression in testis, heart, liver, skeletal muscle, intestine and kidney, followed by brain and lung. No expression in spleen. Isoform 1/D-AKAP1A is expressed predominantly in testis whereas isoform 4/D-AKAP1D is expressed primarily in liver.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000018428 Expressed in 277 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O08715 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O08715 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SLC8A3.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
198048, 3 interactors

Protein interaction database and analysis system

More...
IntActi
O08715, 8 interactors

Molecular INTeraction database

More...
MINTi
O08715

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000018572

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O08715

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O08715

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini561 – 625KHPROSITE-ProRule annotationAdd BLAST65
Domaini712 – 771TudorPROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni306 – 319PKA-RII subunit binding domainAdd BLAST14

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

RII-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.

Keywords - Domaini

Transit peptide, Transmembrane

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2279 Eukaryota
ENOG410Z0DP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000001360

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000013170

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG057436

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O08715

KEGG Orthology (KO)

More...
KOi
K16518

Identification of Orthologs from Complete Genome Data

More...
OMAi
SVQICHI

Database of Orthologous Groups

More...
OrthoDBi
196526at2759

TreeFam database of animal gene trees

More...
TreeFami
TF105401

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.40.50.90, 1 hit
3.30.1370.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033104 Akap1
IPR004087 KH_dom
IPR004088 KH_dom_type_1
IPR036612 KH_dom_type_1_sf
IPR035437 SNase_OB-fold_sf
IPR002999 Tudor

The PANTHER Classification System

More...
PANTHERi
PTHR22948:SF18 PTHR22948:SF18, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00013 KH_1, 1 hit
PF00567 TUDOR, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00322 KH, 1 hit
SM00333 TUDOR, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54791 SSF54791, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50084 KH_TYPE_1, 1 hit
PS50304 TUDOR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 3 (identifier: O08715-1) [UniParc]FASTAAdd to basket
Also known as: D-AKAP1C, AKAP121

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAIQLRSLFP LALPGMLALL GWWWFFSRKK DRLSSSDKQV ETLKVGPAIK
60 70 80 90 100
DRRLSEEACP GVLSVAPTVT QPPGREEQRC VDKPSTEPLA LPRTRQVRRR
110 120 130 140 150
SESSGNLPSV ADTRSQPGPC RDEIAKVELS LMGDKAKSIP LGCPLLPKDA
160 170 180 190 200
SFPYEAVERC KQESALGKTP GRGWPSPYAA SGEKARETGG TEGTGDAVLG
210 220 230 240 250
ENVSEEGLLS QECVSEVEKS EFPILAPGGG EGEEVSHGPP QVAELLKKEE
260 270 280 290 300
YIVGKLPSSF VEPVHSEPVK DEDALEPQVK GSSNTSDRDL AGELDKDETV
310 320 330 340 350
PENDQIKQAA FQLISQVILE ATEEFRATTV GKTVAQVHPT SATQPKGKEE
360 370 380 390 400
SCVPASQETS LGQDTSDPAS TRTGATASPS AEALPPKTYV SCLSSPLSGP
410 420 430 440 450
TKDQKPKNSA HHISLAPCPP PVTPQRQSLE GASNPRGDDN FVACMANNSQ
460 470 480 490 500
SVLSVSSLGQ CSDPVSTSGL EDSCTETISS SGDKAMTPPL PVSTQPFSNG
510 520 530 540 550
VLKEELSDLG TEDGWTMDTE ADHSGGSDGN SMDSVDSCCG LTKPDSPQSV
560 570 580 590 600
QAGSNPKKVD LIIWEIEVPK HLVGRLIGKQ GRYVSFLKQT SGAKIYISTL
610 620 630 640 650
PYTQNIQICH IEGSQHHVDK ALNLIGKKFK ELNLTNIYAP PLPSLALPSL
660 670 680 690 700
PMTSWLMLPD GITVEVIVVN QVNAGHLFVQ QHTHPTFHAL RSLDQQMYLC
710 720 730 740 750
YSQPGIPTLP TPVEITVICA APGADGAWWR AQVVASYEET NEVEIRYVDY
760 770 780 790 800
GGYKRVKVDV LRQIRSDFVT LPFQGAEVLL DSVVPLSDDD HFSPEADAAM
810 820 830 840 850
SEMTGNTALL AQVTSYSATG LPLIQLWSVV GDEVVLINRS LVERGLAQWV

DSYYASL
Length:857
Mass (Da):92,195
Last modified:July 27, 2011 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i455679FCF95C28E6
GO
Isoform 1 (identifier: O08715-2) [UniParc]FASTAAdd to basket
Also known as: D-AKAP1A

The sequence of this isoform differs from the canonical sequence as follows:
     527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC
     545-857: Missing.

Show »
Length:544
Mass (Da):57,680
Checksum:i24F297D5CB332F7A
GO
Isoform 2 (identifier: O08715-3) [UniParc]FASTAAdd to basket
Also known as: D-AKAP1B

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM
     527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC
     545-857: Missing.

Show »
Length:577
Mass (Da):61,311
Checksum:iF18916F0BE7B88A2
GO
Isoform 4 (identifier: O08715-4) [UniParc]FASTAAdd to basket
Also known as: D-AKAP1D

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM

Show »
Length:890
Mass (Da):95,825
Checksum:iB4F8830C72620DF1
GO
Isoform 5 (identifier: O08715-5) [UniParc]FASTAAdd to basket
Also known as: S-AKAP84

The sequence of this isoform differs from the canonical sequence as follows:
     526-547: GSDGNSMDSVDSCCGLTKPDSP → VAAPPQERGHFGNGGCTGFFEC
     548-857: Missing.

Show »
Length:547
Mass (Da):58,000
Checksum:i83069FB21BFA3628
GO
Isoform 6 (identifier: O08715-6) [UniParc]FASTAAdd to basket
Also known as: AKAP100

The sequence of this isoform differs from the canonical sequence as follows:
     614-637: SQHHVDKALNLIGKKFKELNLTNI → CVSVLTRRLSAPCRQSSELDWEEV
     638-857: Missing.

Show »
Length:637
Mass (Da):68,012
Checksum:iE40401F94CFFE7DF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6V317F6V317_MOUSE
A-kinase anchor protein 1, mitochon...
Akap1
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti80C → S in AAC27100 (Ref. 2) Curated1
Sequence conflicti80C → S in AAB53740 (PubMed:9182549).Curated1
Sequence conflicti80C → S in AAB53741 (PubMed:9182549).Curated1
Sequence conflicti220S → I in AAC27100 (Ref. 2) Curated1
Sequence conflicti325F → L in AAC27100 (Ref. 2) Curated1
Sequence conflicti325F → L in AAB53740 (PubMed:9182549).Curated1
Sequence conflicti325F → L in AAB53741 (PubMed:9182549).Curated1
Sequence conflicti327A → P in AAB53740 (PubMed:9182549).Curated1
Sequence conflicti327A → P in AAB53741 (PubMed:9182549).Curated1
Sequence conflicti340T → I in AAC27100 (Ref. 2) Curated1
Sequence conflicti340T → I in AAB53740 (PubMed:9182549).Curated1
Sequence conflicti340T → I in AAB53741 (PubMed:9182549).Curated1
Sequence conflicti486M → I in AAC27100 (Ref. 2) Curated1
Sequence conflicti486M → I in AAB53740 (PubMed:9182549).Curated1
Sequence conflicti486M → I in AAB53741 (PubMed:9182549).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0028471M → MGCKTGPKPFGGGETIRPIR IRRCSYFTSTDSKM in isoform 2 and isoform 4. 1 Publication1
Alternative sequenceiVSP_002850526 – 547GSDGN…KPDSP → VAAPPQERGHFGNGGCTGFF EC in isoform 5. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_002848527 – 544SDGNS…GLTKP → RKVLGCFLGESGRGPIIC in isoform 1 and isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_002849545 – 857Missing in isoform 1 and isoform 2. 1 PublicationAdd BLAST313
Alternative sequenceiVSP_002851548 – 857Missing in isoform 5. 1 PublicationAdd BLAST310
Alternative sequenceiVSP_002852614 – 637SQHHV…NLTNI → CVSVLTRRLSAPCRQSSELD WEEV in isoform 6. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_002853638 – 857Missing in isoform 6. 1 PublicationAdd BLAST220

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U84389 mRNA Translation: AAC27100.1
U95145 mRNA Translation: AAB53740.1
U95146 mRNA Translation: AAB53741.1
AL596180 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS25229.1 [O08715-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001036006.1, NM_001042541.1 [O08715-1]
NP_033778.2, NM_009648.2 [O08715-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.2969

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000018572; ENSMUSP00000018572; ENSMUSG00000018428 [O08715-1]
ENSMUST00000107903; ENSMUSP00000103536; ENSMUSG00000018428 [O08715-1]
ENSMUST00000107904; ENSMUSP00000103537; ENSMUSG00000018428 [O08715-4]
ENSMUST00000143720; ENSMUSP00000122295; ENSMUSG00000018428 [O08715-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11640

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:11640

UCSC genome browser

More...
UCSCi
uc007kvu.2 mouse [O08715-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U84389 mRNA Translation: AAC27100.1
U95145 mRNA Translation: AAB53740.1
U95146 mRNA Translation: AAB53741.1
AL596180 Genomic DNA No translation available.
CCDSiCCDS25229.1 [O08715-1]
RefSeqiNP_001036006.1, NM_001042541.1 [O08715-1]
NP_033778.2, NM_009648.2 [O08715-1]
UniGeneiMm.2969

3D structure databases

ProteinModelPortaliO08715
SMRiO08715
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198048, 3 interactors
IntActiO08715, 8 interactors
MINTiO08715
STRINGi10090.ENSMUSP00000018572

PTM databases

iPTMnetiO08715
PhosphoSitePlusiO08715
SwissPalmiO08715

Proteomic databases

EPDiO08715
jPOSTiO08715
MaxQBiO08715
PaxDbiO08715
PeptideAtlasiO08715
PRIDEiO08715

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
11640
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000018572; ENSMUSP00000018572; ENSMUSG00000018428 [O08715-1]
ENSMUST00000107903; ENSMUSP00000103536; ENSMUSG00000018428 [O08715-1]
ENSMUST00000107904; ENSMUSP00000103537; ENSMUSG00000018428 [O08715-4]
ENSMUST00000143720; ENSMUSP00000122295; ENSMUSG00000018428 [O08715-5]
GeneIDi11640
KEGGimmu:11640
UCSCiuc007kvu.2 mouse [O08715-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8165
MGIiMGI:104729 Akap1

Phylogenomic databases

eggNOGiKOG2279 Eukaryota
ENOG410Z0DP LUCA
GeneTreeiENSGT00390000001360
HOGENOMiHOG000013170
HOVERGENiHBG057436
InParanoidiO08715
KOiK16518
OMAiSVQICHI
OrthoDBi196526at2759
TreeFamiTF105401

Enzyme and pathway databases

ReactomeiR-MMU-983231 Factors involved in megakaryocyte development and platelet production

Miscellaneous databases

Protein Ontology

More...
PROi
PR:O08715

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000018428 Expressed in 277 organ(s), highest expression level in testis
ExpressionAtlasiO08715 baseline and differential
GenevisibleiO08715 MM

Family and domain databases

Gene3Di2.40.50.90, 1 hit
3.30.1370.10, 1 hit
InterProiView protein in InterPro
IPR033104 Akap1
IPR004087 KH_dom
IPR004088 KH_dom_type_1
IPR036612 KH_dom_type_1_sf
IPR035437 SNase_OB-fold_sf
IPR002999 Tudor
PANTHERiPTHR22948:SF18 PTHR22948:SF18, 1 hit
PfamiView protein in Pfam
PF00013 KH_1, 1 hit
PF00567 TUDOR, 1 hit
SMARTiView protein in SMART
SM00322 KH, 1 hit
SM00333 TUDOR, 1 hit
SUPFAMiSSF54791 SSF54791, 1 hit
PROSITEiView protein in PROSITE
PS50084 KH_TYPE_1, 1 hit
PS50304 TUDOR, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAKAP1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O08715
Secondary accession number(s): B1AR25, O08714, P97488
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: July 27, 2011
Last modified: February 13, 2019
This is version 168 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again