Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kininogen-1

Gene

Kng1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

1 Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionProtease inhibitor, Thiol protease inhibitor, Vasoactive, Vasodilator
Biological processBlood coagulation, Hemostasis, Inflammatory response

Enzyme and pathway databases

ReactomeiR-MMU-114608 Platelet degranulation
R-MMU-140837 Intrinsic Pathway of Fibrin Clot Formation
R-MMU-375276 Peptide ligand-binding receptors
R-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-MMU-416476 G alpha (q) signalling events
R-MMU-418594 G alpha (i) signalling events
R-MMU-8957275 Post-translational protein phosphorylation

Protein family/group databases

MEROPSiI25.018

Names & Taxonomyi

Protein namesi
Recommended name:
Kininogen-1
Cleaved into the following 3 chains:
Gene namesi
Name:Kng1
Synonyms:Kng
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:1097705 Kng1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Add BLAST20
ChainiPRO_000000669121 – 661Kininogen-1Add BLAST641
ChainiPRO_000000669221 – 379Kininogen-1 heavy chainAdd BLAST359
PeptideiPRO_0000006693380 – 388Bradykinin9
ChainiPRO_0000006694389 – 661Kininogen-1 light chainAdd BLAST273

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi28 ↔ 631Interchain (between heavy and light chains)PROSITE-ProRule annotation
Glycosylationi82N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi83 ↔ 94PROSITE-ProRule annotation
Disulfide bondi107 ↔ 125PROSITE-ProRule annotation
Disulfide bondi141 ↔ 144PROSITE-ProRule annotation
Glycosylationi168N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi204N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi205 ↔ 217PROSITE-ProRule annotation
Disulfide bondi228 ↔ 247PROSITE-ProRule annotation
Glycosylationi242N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi263 ↔ 266PROSITE-ProRule annotation
Disulfide bondi327 ↔ 339PROSITE-ProRule annotation
Modified residuei331PhosphoserineBy similarity1
Disulfide bondi350 ↔ 369PROSITE-ProRule annotation

Post-translational modificationi

Bradykinin is released from kininogen by plasma kallikrein.
Phosphorylated by FAM20C in the extracellular medium.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiO08677
PaxDbiO08677
PeptideAtlasiO08677
PRIDEiO08677

2D gel databases

REPRODUCTION-2DPAGEiIPI00129225

PTM databases

iPTMnetiO08677
PhosphoSitePlusiO08677
SwissPalmiO08677

Miscellaneous databases

PMAP-CutDBiO08677

Expressioni

Tissue specificityi

Plasma.

Gene expression databases

BgeeiENSMUSG00000022875 Expressed in 41 organ(s), highest expression level in liver
CleanExiMM_KNG1
ExpressionAtlasiO08677 baseline and differential
GenevisibleiO08677 MM

Interactioni

Subunit structurei

Isoform LMW interacts with CRISP3.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi201005, 1 interactor
IntActiO08677, 7 interactors
MINTiO08677
STRINGi10090.ENSMUSP00000023589

Structurei

3D structure databases

ProteinModelPortaliO08677
SMRiO08677
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini28 – 131Cystatin kininogen-type 1PROSITE-ProRule annotationAdd BLAST104
Domaini150 – 253Cystatin kininogen-type 2PROSITE-ProRule annotationAdd BLAST104
Domaini272 – 375Cystatin kininogen-type 3PROSITE-ProRule annotationAdd BLAST104

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi439 – 524His-richAdd BLAST86

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiENOG410IKIQ Eukaryota
ENOG4111ZQ8 LUCA
GeneTreeiENSGT00440000039713
HOGENOMiHOG000113239
HOVERGENiHBG006224
InParanoidiO08677
KOiK03898
PhylomeDBiO08677
TreeFamiTF351852

Family and domain databases

CDDicd00042 CY, 3 hits
InterProiView protein in InterPro
IPR000010 Cystatin_dom
IPR002395 Kininogen
IPR027358 Kininogen-type_cystatin_dom
IPR018073 Prot_inh_cystat_CS
PfamiView protein in Pfam
PF00031 Cystatin, 3 hits
PRINTSiPR00334 KININOGEN
SMARTiView protein in SMART
SM00043 CY, 3 hits
PROSITEiView protein in PROSITE
PS00287 CYSTATIN, 1 hit
PS51647 CYSTATIN_KININOGEN, 3 hits

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform HMW (identifier: O08677-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLITTLLLC SGLLLTLTQG EEAQEIDCND EAVFQAVDFS LKQFNPGVKS
60 70 80 90 100
GNQYMLHRVI EGTKTDGSPT FYSFKYLIKE GNCSAQSGLA WQDCDFKDAE
110 120 130 140 150
EAATGECTAT VGKRENEFFI VTQTCKIAPS KAPILKAYFP CIGCVHAIST
160 170 180 190 200
DSPDLEPVLK HSIEHFNNNT DHSHLFTLRK VKSAHRQVVA GLNFDITYTI
210 220 230 240 250
VQTNCSKERF PSLHGDCVAL PNGDDGECRG NLFMDINNKI ANFSQSCTLY
260 270 280 290 300
SGDDLVEALP KPCPGCPRDI PVDSPELKEV LGHSIAQLNA ENDHPFYYKI
310 320 330 340 350
DTVKKATSQV VAGTKYVIEF IARETKCSKE SNTELAEDCE IKHLGQSLDC
360 370 380 390 400
NANVYMRPWE NKVVPTVKCQ ALDMTEMARR PPGFSPFRSV TVQETKEGRT
410 420 430 440 450
VSPPYIAREQ EERDAETEQG PTHGHGWLHE KQIKANKNHR GHKHGHDHGH
460 470 480 490 500
WSPRRHGLGH GHQKPHGLGH GHQLKLDYLR HQREDGDDHT HTVGHGHGHG
510 520 530 540 550
HGHGHGHGHG HGHGHGHGHG HGHGKHTNKD KNSVKQTTQR TESLASSSEY
560 570 580 590 600
STTSTQMQGR TEGPTLTPPR AQPTVTSSGF QDSDFIEDVV ATTPPYDTGA
610 620 630 640 650
HDDLIPDIHV QPDSLSFKLI SDFPEATSPK CPGRPWKPAS WEDPNTETTE
660
FSDFDLLDAL S
Length:661
Mass (Da):73,102
Last modified:July 1, 1997 - v1
Checksum:i774460258D58796E
GO
Isoform LMW (identifier: O08677-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-432: VSPPYIAREQEERDAETEQGPTHGHGWLHEKQ → RLLRACEYKGRLSKAGAEPAPERQAESSQVKQ
     433-661: Missing.

Show »
Length:432
Mass (Da):47,898
Checksum:i91854EDA5284A16B
GO
Isoform 3 (identifier: O08677-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-581: Missing.

Show »
Length:480
Mass (Da):53,206
Checksum:i7D0AE95FC5AA98DE
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YTY9D3YTY9_MOUSE
Kininogen-1
Kng1
480Annotation score:
A0A0R4J038A0A0R4J038_MOUSE
Kininogen-1
Kng1
661Annotation score:
D3Z2B2D3Z2B2_MOUSE
Kininogen-1
Kng1
133Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti642E → K in AAI08937 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_037159401 – 581Missing in isoform 3. 2 PublicationsAdd BLAST181
Alternative sequenceiVSP_001263401 – 432VSPPY…LHEKQ → RLLRACEYKGRLSKAGAEPA PERQAESSQVKQ in isoform LMW. 3 PublicationsAdd BLAST32
Alternative sequenceiVSP_001264433 – 661Missing in isoform LMW. 3 PublicationsAdd BLAST229

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D84415 mRNA Translation: BAA19742.1
D84435 mRNA Translation: BAA19743.1
AY462058 mRNA Translation: AAR88632.1
AY660571 mRNA Translation: AAT70087.1
AK005547 mRNA No translation available.
BC018158 mRNA Translation: AAH18158.1
BC108936 mRNA Translation: AAI08937.1
CCDSiCCDS28073.1 [O08677-2]
CCDS49803.1 [O08677-3]
CCDS49804.1 [O08677-1]
RefSeqiNP_001095881.1, NM_001102411.1
NP_075614.1, NM_023125.3 [O08677-2]
UniGeneiMm.2160

Genome annotation databases

EnsembliENSMUST00000039492; ENSMUSP00000040485; ENSMUSG00000022875 [O08677-2]
GeneIDi16644
KEGGimmu:16644
UCSCiuc007ytb.1 mouse [O08677-1]
uc007ytc.1 mouse [O08677-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D84415 mRNA Translation: BAA19742.1
D84435 mRNA Translation: BAA19743.1
AY462058 mRNA Translation: AAR88632.1
AY660571 mRNA Translation: AAT70087.1
AK005547 mRNA No translation available.
BC018158 mRNA Translation: AAH18158.1
BC108936 mRNA Translation: AAI08937.1
CCDSiCCDS28073.1 [O08677-2]
CCDS49803.1 [O08677-3]
CCDS49804.1 [O08677-1]
RefSeqiNP_001095881.1, NM_001102411.1
NP_075614.1, NM_023125.3 [O08677-2]
UniGeneiMm.2160

3D structure databases

ProteinModelPortaliO08677
SMRiO08677
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201005, 1 interactor
IntActiO08677, 7 interactors
MINTiO08677
STRINGi10090.ENSMUSP00000023589

Protein family/group databases

MEROPSiI25.018

PTM databases

iPTMnetiO08677
PhosphoSitePlusiO08677
SwissPalmiO08677

2D gel databases

REPRODUCTION-2DPAGEiIPI00129225

Proteomic databases

MaxQBiO08677
PaxDbiO08677
PeptideAtlasiO08677
PRIDEiO08677

Protocols and materials databases

DNASUi16644
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000039492; ENSMUSP00000040485; ENSMUSG00000022875 [O08677-2]
GeneIDi16644
KEGGimmu:16644
UCSCiuc007ytb.1 mouse [O08677-1]
uc007ytc.1 mouse [O08677-2]

Organism-specific databases

CTDi3827
MGIiMGI:1097705 Kng1

Phylogenomic databases

eggNOGiENOG410IKIQ Eukaryota
ENOG4111ZQ8 LUCA
GeneTreeiENSGT00440000039713
HOGENOMiHOG000113239
HOVERGENiHBG006224
InParanoidiO08677
KOiK03898
PhylomeDBiO08677
TreeFamiTF351852

Enzyme and pathway databases

ReactomeiR-MMU-114608 Platelet degranulation
R-MMU-140837 Intrinsic Pathway of Fibrin Clot Formation
R-MMU-375276 Peptide ligand-binding receptors
R-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-MMU-416476 G alpha (q) signalling events
R-MMU-418594 G alpha (i) signalling events
R-MMU-8957275 Post-translational protein phosphorylation

Miscellaneous databases

PMAP-CutDBiO08677
PROiPR:O08677
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022875 Expressed in 41 organ(s), highest expression level in liver
CleanExiMM_KNG1
ExpressionAtlasiO08677 baseline and differential
GenevisibleiO08677 MM

Family and domain databases

CDDicd00042 CY, 3 hits
InterProiView protein in InterPro
IPR000010 Cystatin_dom
IPR002395 Kininogen
IPR027358 Kininogen-type_cystatin_dom
IPR018073 Prot_inh_cystat_CS
PfamiView protein in Pfam
PF00031 Cystatin, 3 hits
PRINTSiPR00334 KININOGEN
SMARTiView protein in SMART
SM00043 CY, 3 hits
PROSITEiView protein in PROSITE
PS00287 CYSTATIN, 1 hit
PS51647 CYSTATIN_KININOGEN, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiKNG1_MOUSE
AccessioniPrimary (citable) accession number: O08677
Secondary accession number(s): O08676
, Q32MX7, Q6S9I1, Q91XK5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 1, 1997
Last modified: November 7, 2018
This is version 168 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again