Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 176 (18 Sep 2019)
Sequence version 1 (01 Jul 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Kininogen-1

Gene

Kng1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

1 Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionProtease inhibitor, Thiol protease inhibitor, Vasoactive, Vasodilator
Biological processBlood coagulation, Hemostasis, Inflammatory response

Protein family/group databases

MEROPS protease database

More...
MEROPSi
I25.018

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kininogen-1
Cleaved into the following 3 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kng1
Synonyms:Kng
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1097705 Kng1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 20Add BLAST20
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000669121 – 661Kininogen-1Add BLAST641
ChainiPRO_000000669221 – 379Kininogen-1 heavy chainAdd BLAST359
<p>This subsection of the ‘PTM / Processing’ section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_0000006693380 – 388Bradykinin9
ChainiPRO_0000006694389 – 661Kininogen-1 light chainAdd BLAST273

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi28 ↔ 631Interchain (between heavy and light chains)PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi82N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi83 ↔ 94PROSITE-ProRule annotation
Disulfide bondi107 ↔ 125PROSITE-ProRule annotation
Disulfide bondi141 ↔ 144PROSITE-ProRule annotation
Glycosylationi168N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi204N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi205 ↔ 217PROSITE-ProRule annotation
Disulfide bondi228 ↔ 247PROSITE-ProRule annotation
Glycosylationi242N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi263 ↔ 266PROSITE-ProRule annotation
Disulfide bondi327 ↔ 339PROSITE-ProRule annotation
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei331PhosphoserineBy similarity1
Disulfide bondi350 ↔ 369PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Bradykinin is released from kininogen by plasma kallikrein.
Phosphorylated by FAM20C in the extracellular medium.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
non-CPTAC-3506

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O08677

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O08677

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O08677

PeptideAtlas

More...
PeptideAtlasi
O08677

PRoteomics IDEntifications database

More...
PRIDEi
O08677

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00129225

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2451

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O08677

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O08677

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O08677

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
O08677

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Plasma.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000022875 Expressed in 41 organ(s), highest expression level in liver

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O08677 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O08677 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform LMW interacts with CRISP3.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
201005, 1 interactor

Protein interaction database and analysis system

More...
IntActi
O08677, 7 interactors

Molecular INTeraction database

More...
MINTi
O08677

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000023589

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O08677

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini28 – 131Cystatin kininogen-type 1PROSITE-ProRule annotationAdd BLAST104
Domaini150 – 253Cystatin kininogen-type 2PROSITE-ProRule annotationAdd BLAST104
Domaini272 – 375Cystatin kininogen-type 3PROSITE-ProRule annotationAdd BLAST104

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi439 – 524His-richAdd BLAST86

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IKIQ Eukaryota
ENOG4111ZQ8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182930

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113239

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O08677

KEGG Orthology (KO)

More...
KOi
K03898

Database of Orthologous Groups

More...
OrthoDBi
740995at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O08677

TreeFam database of animal gene trees

More...
TreeFami
TF351852

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00042 CY, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000010 Cystatin_dom
IPR002395 Kininogen
IPR027358 Kininogen-type_cystatin_dom
IPR018073 Prot_inh_cystat_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00031 Cystatin, 3 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00334 KININOGEN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00043 CY, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00287 CYSTATIN, 1 hit
PS51647 CYSTATIN_KININOGEN, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform HMW (identifier: O08677-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLITTLLLC SGLLLTLTQG EEAQEIDCND EAVFQAVDFS LKQFNPGVKS
60 70 80 90 100
GNQYMLHRVI EGTKTDGSPT FYSFKYLIKE GNCSAQSGLA WQDCDFKDAE
110 120 130 140 150
EAATGECTAT VGKRENEFFI VTQTCKIAPS KAPILKAYFP CIGCVHAIST
160 170 180 190 200
DSPDLEPVLK HSIEHFNNNT DHSHLFTLRK VKSAHRQVVA GLNFDITYTI
210 220 230 240 250
VQTNCSKERF PSLHGDCVAL PNGDDGECRG NLFMDINNKI ANFSQSCTLY
260 270 280 290 300
SGDDLVEALP KPCPGCPRDI PVDSPELKEV LGHSIAQLNA ENDHPFYYKI
310 320 330 340 350
DTVKKATSQV VAGTKYVIEF IARETKCSKE SNTELAEDCE IKHLGQSLDC
360 370 380 390 400
NANVYMRPWE NKVVPTVKCQ ALDMTEMARR PPGFSPFRSV TVQETKEGRT
410 420 430 440 450
VSPPYIAREQ EERDAETEQG PTHGHGWLHE KQIKANKNHR GHKHGHDHGH
460 470 480 490 500
WSPRRHGLGH GHQKPHGLGH GHQLKLDYLR HQREDGDDHT HTVGHGHGHG
510 520 530 540 550
HGHGHGHGHG HGHGHGHGHG HGHGKHTNKD KNSVKQTTQR TESLASSSEY
560 570 580 590 600
STTSTQMQGR TEGPTLTPPR AQPTVTSSGF QDSDFIEDVV ATTPPYDTGA
610 620 630 640 650
HDDLIPDIHV QPDSLSFKLI SDFPEATSPK CPGRPWKPAS WEDPNTETTE
660
FSDFDLLDAL S
Length:661
Mass (Da):73,102
Last modified:July 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i774460258D58796E
GO
Isoform LMW (identifier: O08677-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-432: VSPPYIAREQEERDAETEQGPTHGHGWLHEKQ → RLLRACEYKGRLSKAGAEPAPERQAESSQVKQ
     433-661: Missing.

Show »
Length:432
Mass (Da):47,898
Checksum:i91854EDA5284A16B
GO
Isoform 3 (identifier: O08677-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-581: Missing.

Show »
Length:480
Mass (Da):53,206
Checksum:i7D0AE95FC5AA98DE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0R4J038A0A0R4J038_MOUSE
Kininogen-1
Kng1
661Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YTY9D3YTY9_MOUSE
Kininogen-1
Kng1
480Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z2B2D3Z2B2_MOUSE
Kininogen-1
Kng1
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti642E → K in AAI08937 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_037159401 – 581Missing in isoform 3. 2 PublicationsAdd BLAST181
Alternative sequenceiVSP_001263401 – 432VSPPY…LHEKQ → RLLRACEYKGRLSKAGAEPA PERQAESSQVKQ in isoform LMW. 3 PublicationsAdd BLAST32
Alternative sequenceiVSP_001264433 – 661Missing in isoform LMW. 3 PublicationsAdd BLAST229

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D84415 mRNA Translation: BAA19742.1
D84435 mRNA Translation: BAA19743.1
AY462058 mRNA Translation: AAR88632.1
AY660571 mRNA Translation: AAT70087.1
AK005547 mRNA No translation available.
BC018158 mRNA Translation: AAH18158.1
BC108936 mRNA Translation: AAI08937.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28073.1 [O08677-2]
CCDS49803.1 [O08677-3]
CCDS49804.1 [O08677-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001095881.1, NM_001102411.1
NP_075614.1, NM_023125.3 [O08677-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000039492; ENSMUSP00000040485; ENSMUSG00000022875 [O08677-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
16644

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:16644

UCSC genome browser

More...
UCSCi
uc007ytb.1 mouse [O08677-1]
uc007ytc.1 mouse [O08677-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D84415 mRNA Translation: BAA19742.1
D84435 mRNA Translation: BAA19743.1
AY462058 mRNA Translation: AAR88632.1
AY660571 mRNA Translation: AAT70087.1
AK005547 mRNA No translation available.
BC018158 mRNA Translation: AAH18158.1
BC108936 mRNA Translation: AAI08937.1
CCDSiCCDS28073.1 [O08677-2]
CCDS49803.1 [O08677-3]
CCDS49804.1 [O08677-1]
RefSeqiNP_001095881.1, NM_001102411.1
NP_075614.1, NM_023125.3 [O08677-2]

3D structure databases

SMRiO08677
ModBaseiSearch...

Protein-protein interaction databases

BioGridi201005, 1 interactor
IntActiO08677, 7 interactors
MINTiO08677
STRINGi10090.ENSMUSP00000023589

Protein family/group databases

MEROPSiI25.018

PTM databases

GlyConnecti2451
iPTMnetiO08677
PhosphoSitePlusiO08677
SwissPalmiO08677

2D gel databases

REPRODUCTION-2DPAGEiIPI00129225

Proteomic databases

CPTACinon-CPTAC-3506
jPOSTiO08677
MaxQBiO08677
PaxDbiO08677
PeptideAtlasiO08677
PRIDEiO08677

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
16644

Genome annotation databases

EnsembliENSMUST00000039492; ENSMUSP00000040485; ENSMUSG00000022875 [O08677-2]
GeneIDi16644
KEGGimmu:16644
UCSCiuc007ytb.1 mouse [O08677-1]
uc007ytc.1 mouse [O08677-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3827
MGIiMGI:1097705 Kng1

Phylogenomic databases

eggNOGiENOG410IKIQ Eukaryota
ENOG4111ZQ8 LUCA
GeneTreeiENSGT00950000182930
HOGENOMiHOG000113239
InParanoidiO08677
KOiK03898
OrthoDBi740995at2759
PhylomeDBiO08677
TreeFamiTF351852

Miscellaneous databases

PMAP-CutDBiO08677

Protein Ontology

More...
PROi
PR:O08677

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000022875 Expressed in 41 organ(s), highest expression level in liver
ExpressionAtlasiO08677 baseline and differential
GenevisibleiO08677 MM

Family and domain databases

CDDicd00042 CY, 3 hits
InterProiView protein in InterPro
IPR000010 Cystatin_dom
IPR002395 Kininogen
IPR027358 Kininogen-type_cystatin_dom
IPR018073 Prot_inh_cystat_CS
PfamiView protein in Pfam
PF00031 Cystatin, 3 hits
PRINTSiPR00334 KININOGEN
SMARTiView protein in SMART
SM00043 CY, 3 hits
PROSITEiView protein in PROSITE
PS00287 CYSTATIN, 1 hit
PS51647 CYSTATIN_KININOGEN, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKNG1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O08677
Secondary accession number(s): O08676
, Q32MX7, Q6S9I1, Q91XK5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 1, 1997
Last modified: September 18, 2019
This is version 176 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again