Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 159 (08 May 2019)
Sequence version 1 (01 Jul 1997)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Myosin-11

Gene

Myh11

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Muscle contraction.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi178 – 185ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Calmodulin-binding, Motor protein, Muscle protein, Myosin
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-445355 Smooth Muscle Contraction
R-MMU-5627123 RHO GTPases activate PAKs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myosin-11
Alternative name(s):
Myosin heavy chain 11
Myosin heavy chain, smooth muscle isoform
SMMHC
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Myh11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:102643 Myh11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Thick filament

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001234251 – 1972Myosin-11Add BLAST1972

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei8PhosphoserineCombined sources1
Modified residuei23PhosphoserineBy similarity1
Modified residuei40PhosphoserineBy similarity1
Modified residuei129N6,N6,N6-trimethyllysineSequence analysis1
Modified residuei1177PhosphothreonineBy similarity1
Modified residuei1684PhosphoserineBy similarity1
Modified residuei1722PhosphoserineBy similarity1
Modified residuei1951PhosphothreonineCombined sources1
Modified residuei1954PhosphoserineCombined sources1
Modified residuei1971PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O08638

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O08638

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O08638

PeptideAtlas

More...
PeptideAtlasi
O08638

PRoteomics IDEntifications database

More...
PRIDEi
O08638

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O08638

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O08638

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O08638

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2).

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
O08638, 14 interactors

Molecular INTeraction database

More...
MINTi
O08638

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000087756

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O08638

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 81Myosin N-terminal SH3-likePROSITE-ProRule annotationAdd BLAST51
Domaini85 – 783Myosin motorPROSITE-ProRule annotationAdd BLAST699
Domaini786 – 815IQPROSITE-ProRule annotationAdd BLAST30

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni661 – 683Actin-bindingBy similarityAdd BLAST23
Regioni762 – 776Actin-bindingBy similarityAdd BLAST15
Regioni1935 – 1972C-terminalAdd BLAST38

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili844 – 1934Sequence analysisAdd BLAST1091

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils.
Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2).Curated

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0161 Eukaryota
COG5022 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000173958

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O08638

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O08638

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.30.360, 1 hit
3.40.850.10, 1 hit
4.10.270.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000048 IQ_motif_EF-hand-BS
IPR036961 Kinesin_motor_dom_sf
IPR001609 Myosin_head_motor_dom
IPR027401 Myosin_IQ_contain_sf
IPR004009 Myosin_N
IPR008989 Myosin_S1_N
IPR002928 Myosin_tail
IPR027417 P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00063 Myosin_head, 1 hit
PF02736 Myosin_N, 1 hit
PF01576 Myosin_tail_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00193 MYOSINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00242 MYSc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50096 IQ, 1 hit
PS51456 MYOSIN_MOTOR, 1 hit
PS51844 SH3_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O08638-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQKGQLSDD EKFLFVDKNF MNSPMAQADW VAKKLVWVPS EKQGFEAASI
60 70 80 90 100
KEEKGDEVVV ELVENGKKVT VGKDDIQKMN PPKFSKVEDM AELTCLNEAS
110 120 130 140 150
VLHNLRERYF SGLIYTYSGL FCVVVNPYKY LPIYSEKIVD MYKGKKRHEM
160 170 180 190 200
PPHIYAIADT AYRSMLQDRE DQSILCTGES GAGKTENTQK VIQYLAVVAS
210 220 230 240 250
SHKGKKDSSI TGELEKQLLQ ANPILEAFGN AKTVKNDNSS RFGKFIRINF
260 270 280 290 300
DVTGYIVGAN IETYLLEKSR AIRQARDERT FHIFYYLLAG AKEKMKSDLL
310 320 330 340 350
LESFNSYTFL SNGFVPIPAA QDDEMFQETL EAMSIMGFNE EEQLAILKVV
360 370 380 390 400
SSVLQLGNIV FKKERNTDQA SMPDNTAAQK VCHLVGINVT DFTRAILTPR
410 420 430 440 450
IKVGRDVVQK AQTKEQADFA IEALAKATYE RLFRWILSRV NKALDKTHRQ
460 470 480 490 500
GASFLGILDI AGFEIFEVNS FEQLCINYTN EKLQQLFNHT MFILEQEEYQ
510 520 530 540 550
REGIEWNFID FGLDLQPSIE LIERPNNPPG VLALLDEECW FPKATDKSFV
560 570 580 590 600
EKLCSEQGNH PKFQKPKQLK DKTEFSIIHY AGKVDYNASA WLTKNMDPLN
610 620 630 640 650
DNVTSLLNAS SDKFVADLWK DVDRIVGLDQ MAKMTESSLP SASKTKKGMF
660 670 680 690 700
RTVGQLYKEQ LGKLMATLRN TTANFVRCII PNHEKRSGKL DAFLVLEQLR
710 720 730 740 750
CNGVLEGIRI CRQGFPNRIV FQEFRQRYEI LAANAIPKGF MDGKQACILM
760 770 780 790 800
IKALELDPNL YRIGQSKIFF RTGVLAHLEE ERDLKITDVI MAFQAMCRGY
810 820 830 840 850
LARKAFTKRQ QQLTAMKVIQ RNCAAYLKLR NWQWWRLFTK VKPLLQVTRQ
860 870 880 890 900
EEEMQAKEEE MQKITERQQK AETELKELEQ KHTQLAEEKT LLQEQLQAET
910 920 930 940 950
ELYAESEEMR VRLAAKKQEL EEILHEMEAR LEEEEDRRQQ LQAERKKMAQ
960 970 980 990 1000
QMLDLEEQLE EEEAARQKLQ LEKVTAEAKI KKLEDDILVM DDQNSKLSKE
1010 1020 1030 1040 1050
RKLLEERVSD LTTNLAEEEE KAKNLTKLKS KHESMISELE VRLKKEEKSR
1060 1070 1080 1090 1100
QELEKLKRKL EGDASDFHEQ IADLQAQIAE LKMQLAKKEE ELQAALARLD
1110 1120 1130 1140 1150
EEIAQKNNAL KKIRELEGHI SDLQEDLDSE RAARNKAEKQ KRDLGEELEA
1160 1170 1180 1190 1200
LKTELEDTLD STATQQELRA KREQEVTVLK KALDEETRSH EAQVQEMRQK
1210 1220 1230 1240 1250
HTQAVEELTE QLEQFKRAKA NLDKSKQTLE KENADLAGEL RVLGQAKQEV
1260 1270 1280 1290 1300
EHKKKKLEVQ LQDLQSKCSD GERARAELSD KVHKLQNEVE SVTGMLNEAE
1310 1320 1330 1340 1350
GKAIKLAKDV ASLGSQLQDT QELLQEETRQ KLNVSTKLRQ LEDERNSLQD
1360 1370 1380 1390 1400
QLDEEMEAKQ NLERHVSTLN IQLSDSKKKL QDFASTIEVM EEGKKRLQKE
1410 1420 1430 1440 1450
MEGLSQQYEE KAAAYDKLEK TKNRLQQELD DLVVDLDNQR QLVSNLEKKQ
1460 1470 1480 1490 1500
KKFDQLLAEE KNISSKYADE RDRAEAEARE KETKALSLAR ALEEALEAKE
1510 1520 1530 1540 1550
ELERTNKMLK AEMEDLVSSK DDVGKNVHEL EKSKRALETQ MEEMKTQLEE
1560 1570 1580 1590 1600
SEDDVQATED AKLRLEVNMQ ALKGQFERDL QARDEQNEEK RRQLQRQLHE
1610 1620 1630 1640 1650
YETELEDERK QRALAAAAKK KLEGDLKDLE LQADSAIKGR EEAIKQLRKL
1660 1670 1680 1690 1700
QAQMKDFQRE LDDARASRDE IFATSKENEK KAKSLEADLM QLQEDLAAAE
1710 1720 1730 1740 1750
RARKQADLEK EELAEELASS LSGRNTLQDE KRRLEARIAQ LEEELEEEQG
1760 1770 1780 1790 1800
NMEAMSDRVR KATLQAEQLS NELATERSTA QKNESARQQL ERQNKELRSK
1810 1820 1830 1840 1850
LQEVEGAVKA KLKSTVAALE AKIAQLEEQV EQEAREKQAA TKSLKQKDKK
1860 1870 1880 1890 1900
LKEVLLQVED ERKMAEQYKE QAEKGNTKVK QLKRQLEEAE EESQCINANR
1910 1920 1930 1940 1950
RKLQRELDEA TESNEAMGRE VNALKSKLRR GNEASFVPSR RAGGRRVIEN
1960 1970
TDGSEEEMDA RDSDFNGTKA SE
Length:1,972
Mass (Da):227,028
Last modified:July 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA1398E3F5B11F15A
GO
Isoform 2 (identifier: O08638-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1930-1972: RGNEASFVPSRRAGGRRVIENTDGSEEEMDARDSDFNGTKASE → GPPPQETSQ

Show »
Length:1,938
Mass (Da):223,266
Checksum:i46A0B1B9BCB63A8A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8VHF9A0A2R8VHF9_MOUSE
Myosin-11
Myh11
1,938Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A338P6K2A0A338P6K2_MOUSE
Myosin-11
Myh11
1,979Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QPE7E9QPE7_MOUSE
Myosin-11
Myh11
1,972Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti126N → D in AAB36168 (PubMed:8593698).Curated1
Sequence conflicti161A → V in AAA67552 (PubMed:7923625).Curated1
Sequence conflicti189Q → K in AAA67552 (PubMed:7923625).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0033461930 – 1972RGNEA…TKASE → GPPPQETSQ in isoform 2. CuratedAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D85923 mRNA Translation: BAA19690.1
D85924 mRNA Translation: BAA19691.1
L25860 mRNA Translation: AAA67552.1
S81516 mRNA Translation: AAB36168.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS27972.1 [O08638-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
I52863
JC5420
JC5421

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D85923 mRNA Translation: BAA19690.1
D85924 mRNA Translation: BAA19691.1
L25860 mRNA Translation: AAA67552.1
S81516 mRNA Translation: AAB36168.1
CCDSiCCDS27972.1 [O08638-2]
PIRiI52863
JC5420
JC5421

3D structure databases

SMRiO08638
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiO08638, 14 interactors
MINTiO08638
STRINGi10090.ENSMUSP00000087756

PTM databases

iPTMnetiO08638
PhosphoSitePlusiO08638
SwissPalmiO08638

Proteomic databases

jPOSTiO08638
MaxQBiO08638
PaxDbiO08638
PeptideAtlasiO08638
PRIDEiO08638

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:102643 Myh11

Phylogenomic databases

eggNOGiKOG0161 Eukaryota
COG5022 LUCA
HOGENOMiHOG000173958
InParanoidiO08638
PhylomeDBiO08638

Enzyme and pathway databases

ReactomeiR-MMU-445355 Smooth Muscle Contraction
R-MMU-5627123 RHO GTPases activate PAKs

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Myh11 mouse

Protein Ontology

More...
PROi
PR:O08638

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

Gene3Di2.30.30.360, 1 hit
3.40.850.10, 1 hit
4.10.270.10, 1 hit
InterProiView protein in InterPro
IPR000048 IQ_motif_EF-hand-BS
IPR036961 Kinesin_motor_dom_sf
IPR001609 Myosin_head_motor_dom
IPR027401 Myosin_IQ_contain_sf
IPR004009 Myosin_N
IPR008989 Myosin_S1_N
IPR002928 Myosin_tail
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF00063 Myosin_head, 1 hit
PF02736 Myosin_N, 1 hit
PF01576 Myosin_tail_1, 1 hit
PRINTSiPR00193 MYOSINHEAVY
SMARTiView protein in SMART
SM00242 MYSc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50096 IQ, 1 hit
PS51456 MYOSIN_MOTOR, 1 hit
PS51844 SH3_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYH11_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O08638
Secondary accession number(s): O08639, Q62462, Q64195
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: July 1, 1997
Last modified: May 8, 2019
This is version 159 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again