Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microsomal triglyceride transfer protein large subunit

Gene

Mttp

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the transport of triglyceride, cholesteryl ester, and phospholipid between phospholipid surfaces. Required for the secretion of plasma lipoproteins that contain apolipoprotein B. May be involved in regulating cholesteryl ester biosynthesis in cells that produce lipoproteins. Loads phospholipid into the C1D1 antigen-binding groove. Isoform 2 is critical for the development of natural killer T (NKT) cells. May have a role in the biogenesis of lipid droplets.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCholesterol metabolism, Lipid metabolism, Lipid transport, Steroid metabolism, Sterol metabolism, Transport
LigandLipid-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-8866423 VLDL assembly
R-MMU-8963888 Chylomicron assembly

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Microsomal triglyceride transfer protein large subunit
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Mttp
Synonyms:Mtp
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:106926 Mttp

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Lowers plasma and tissue triglyceride levels, and increases cellular free cholesterol.2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Add BLAST21
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000004159522 – 894Microsomal triglyceride transfer protein large subunitAdd BLAST873

Keywords - PTMi

Disulfide bond

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O08601

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O08601

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O08601

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O08601

PeptideAtlas

More...
PeptideAtlasi
O08601

PRoteomics IDEntifications database

More...
PRIDEi
O08601

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
O08601

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O08601

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O08601

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O08601

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart. Isoform 1 is mainly expressed in the intestine and the liver, and at lower levels in white and brown fat cells. Isoform 2 is ubiquitous, and is the major isoform in hematopoietic cells and adipocytes.3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expression in the yolk sac tissues followed by expression in the primordial liver cell nests as early as day 9 post-coitum (E9.5). Intestinal expression is detected around E12.5 and attains full adult expression patterns by E14.5.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by FOXO1. Expressed in a circadian manner in the liver.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000028158 Expressed in 238 organ(s), highest expression level in intestine

CleanEx database of gene expression profiles

More...
CleanExi
MM_MTTP

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O08601 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer; heterodimerizes with the protein disulfide isomerase (P4HB/PDI). Interacts with APOB.By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
201601, 1 interactor

Protein interaction database and analysis system

More...
IntActi
O08601, 6 interactors

Molecular INTeraction database

More...
MINTi
O08601

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000096179

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O08601

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini28 – 658VitellogeninPROSITE-ProRule annotationAdd BLAST631

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4337 Eukaryota
ENOG410YKCW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000011412

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113688

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006416

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O08601

KEGG Orthology (KO)

More...
KOi
K14463

Identification of Orthologs from Complete Genome Data

More...
OMAi
EHWQSIR

Database of Orthologous Groups

More...
OrthoDBi
673565at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O08601

TreeFam database of animal gene trees

More...
TreeFami
TF328754

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.20, 1 hit
2.30.230.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015819 Lipid_transp_b-sht_shell
IPR001747 Lipid_transpt_N
IPR011030 Lipovitellin_superhlx_dom
IPR039988 MTTP
IPR015816 Vitellinogen_b-sht_N

The PANTHER Classification System

More...
PANTHERi
PTHR13024 PTHR13024, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01347 Vitellogenin_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00638 LPD_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48431 SSF48431, 1 hit
SSF56968 SSF56968, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51211 VITELLOGENIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage. AlignAdd to basket
Isoform 1 (identifier: O08601-1) [UniParc]FASTAAdd to basket
Also known as: MTP-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MILLAVLFLC FFSSYSASVK GHTTGLSLNN ERLYKLTYST EVFLDGGKGK
60 70 80 90 100
PQDSVGYKIS SDVDVVLLWR NPDGDDDQVI QVTITAVNVE NAGQQRGEKS
110 120 130 140 150
IFQGKSTPKI IGKDNLEALQ RPMLLHLVRG KVKEFYSYEN EPVGIENLKR
160 170 180 190 200
GLASLFQMQL SSGTTNEVDI SGDCKVTYQA QQDKVVKIKA LDTCKIERSG
210 220 230 240 250
FTTANQVLGV SSKATSVTTY KIEDSFVTAV LAEETRAFAL NFQQTIAGKI
260 270 280 290 300
VSKQKLELKT TEAGPRMIPG KQVAGVIKAV DSKYKAIPIV GQVLERVCKG
310 320 330 340 350
CPSLAEHWKS IRKNLEPENL SKAEAVQSFL AFIQHLRTSR REEILQILKA
360 370 380 390 400
EKKEVLPQLV DAVTSAQTPD SLEAILDFLD FKSDSSIILQ ERFLYACGFA
410 420 430 440 450
THPDEELLRA LLSKFKGSFA SNDIRESVMI IIGALVRKLC QNEGCKLKAV
460 470 480 490 500
VEAKKLILGG LEKPEKKEDT TMYLLALKNA LLPEGIPLLL KYAEAGEGPV
510 520 530 540 550
SHLATTVLQR YDVSFITDEV KKTLNRIYHQ NRKVHEKTVR TTAAAVILKN
560 570 580 590 600
PSYMDVKNIL LSIGELPKEM NKYMLTVVQD ILHFEMPASK MIRRVLKEMA
610 620 630 640 650
VHNYDRFSKS GSSSAYTGYV ERSPRAASTY SLDILYSGSG ILRRSNLNIF
660 670 680 690 700
QYIGKAELHG SQVVIEAQGL EGLIAATPDE GEENLDSYAG MSAILFDVQL
710 720 730 740 750
RPVTFFNGYS DLMSKMLSAS GDPVSVVKGL ILLIDHSQDI QLQSGLKANM
760 770 780 790 800
EIQGGLAIDI SGSMEFSLWY RESKTRVKNR VAVVITSDVT VDASFVKAGV
810 820 830 840 850
ESRAETEAGL EFISTVQFSQ YPFLVCMQMD KAEAPLRQFE TKYERLSTGR
860 870 880 890
GYVSRRRKES LVAGCELPLH QENSEMCNVV FPPQPESDNS GGWF
Length:894
Mass (Da):99,099
Last modified:January 19, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3D8E5EB470CAA6FC
GO
Isoform 2 (identifier: O08601-2) [UniParc]FASTAAdd to basket
Also known as: MTPv1, MTP-B

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MILLAVLFLCFFSSYSASVK → MTVVMGKCQVSDGRQLLLFYAVLLLFPTLCAMQNS

Note: Cleaved by signal peptidase between residues Gln-33 and Asn-34 (PubMed:17312007 and PubMed:17635917).
Show »
Length:909
Mass (Da):100,751
Checksum:i522AD2682867FA4A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti654 – 656GKA → KGT in AAB51431 (PubMed:8660984).Curated3
Sequence conflicti654 – 656GKA → KGT in ACB41497 (PubMed:17312007).Curated3
Sequence conflicti800V → L in AAB51431 (PubMed:8660984).Curated1
Sequence conflicti800V → L in ACB41497 (PubMed:17312007).Curated1
Sequence conflicti800V → L in AAH12686 (Ref. 4) Curated1
Sequence conflicti800V → L in EDL12110 (PubMed:15489334).Curated1
Sequence conflicti872E → Q in AAB51431 (PubMed:8660984).Curated1
Sequence conflicti872E → Q in ACB41497 (PubMed:17312007).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0385461 – 20MILLA…SASVK → MTVVMGKCQVSDGRQLLLFY AVLLLFPTLCAMQNS in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L47970 mRNA Translation: AAB51431.1
EU553486 mRNA Translation: ACB41497.1
AK146553 mRNA Translation: BAE27255.1
CH466532 Genomic DNA Translation: EDL12110.1
BC012686 mRNA Translation: AAH12686.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS38650.1 [O08601-1]
CCDS51080.1 [O08601-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001156929.1, NM_001163457.1 [O08601-2]
NP_032668.2, NM_008642.2 [O08601-1]
XP_006501165.1, XM_006501102.3 [O08601-2]
XP_006501166.1, XM_006501103.3 [O08601-1]
XP_017174963.1, XM_017319474.1
XP_017174964.1, XM_017319475.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.2941

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000029805; ENSMUSP00000029805; ENSMUSG00000028158 [O08601-1]
ENSMUST00000098580; ENSMUSP00000096179; ENSMUSG00000028158 [O08601-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
17777

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:17777

UCSC genome browser

More...
UCSCi
uc008rmw.2 mouse [O08601-1]
uc008rmx.2 mouse [O08601-2]

Keywords - Coding sequence diversityi

Alternative promoter usage

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L47970 mRNA Translation: AAB51431.1
EU553486 mRNA Translation: ACB41497.1
AK146553 mRNA Translation: BAE27255.1
CH466532 Genomic DNA Translation: EDL12110.1
BC012686 mRNA Translation: AAH12686.1
CCDSiCCDS38650.1 [O08601-1]
CCDS51080.1 [O08601-2]
RefSeqiNP_001156929.1, NM_001163457.1 [O08601-2]
NP_032668.2, NM_008642.2 [O08601-1]
XP_006501165.1, XM_006501102.3 [O08601-2]
XP_006501166.1, XM_006501103.3 [O08601-1]
XP_017174963.1, XM_017319474.1
XP_017174964.1, XM_017319475.1
UniGeneiMm.2941

3D structure databases

ProteinModelPortaliO08601
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201601, 1 interactor
IntActiO08601, 6 interactors
MINTiO08601
STRINGi10090.ENSMUSP00000096179

PTM databases

CarbonylDBiO08601
iPTMnetiO08601
PhosphoSitePlusiO08601
SwissPalmiO08601

Proteomic databases

EPDiO08601
jPOSTiO08601
MaxQBiO08601
PaxDbiO08601
PeptideAtlasiO08601
PRIDEiO08601

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000029805; ENSMUSP00000029805; ENSMUSG00000028158 [O08601-1]
ENSMUST00000098580; ENSMUSP00000096179; ENSMUSG00000028158 [O08601-2]
GeneIDi17777
KEGGimmu:17777
UCSCiuc008rmw.2 mouse [O08601-1]
uc008rmx.2 mouse [O08601-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4547
MGIiMGI:106926 Mttp

Phylogenomic databases

eggNOGiKOG4337 Eukaryota
ENOG410YKCW LUCA
GeneTreeiENSGT00390000011412
HOGENOMiHOG000113688
HOVERGENiHBG006416
InParanoidiO08601
KOiK14463
OMAiEHWQSIR
OrthoDBi673565at2759
PhylomeDBiO08601
TreeFamiTF328754

Enzyme and pathway databases

ReactomeiR-MMU-8866423 VLDL assembly
R-MMU-8963888 Chylomicron assembly

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Mttp mouse

Protein Ontology

More...
PROi
PR:O08601

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000028158 Expressed in 238 organ(s), highest expression level in intestine
CleanExiMM_MTTP
GenevisibleiO08601 MM

Family and domain databases

Gene3Di1.25.10.20, 1 hit
2.30.230.10, 1 hit
InterProiView protein in InterPro
IPR015819 Lipid_transp_b-sht_shell
IPR001747 Lipid_transpt_N
IPR011030 Lipovitellin_superhlx_dom
IPR039988 MTTP
IPR015816 Vitellinogen_b-sht_N
PANTHERiPTHR13024 PTHR13024, 1 hit
PfamiView protein in Pfam
PF01347 Vitellogenin_N, 1 hit
SMARTiView protein in SMART
SM00638 LPD_N, 1 hit
SUPFAMiSSF48431 SSF48431, 1 hit
SSF56968 SSF56968, 1 hit
PROSITEiView protein in PROSITE
PS51211 VITELLOGENIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMTP_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O08601
Secondary accession number(s): B2CXA7, Q3UJA0, Q91X33
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 19, 2010
Last modified: January 16, 2019
This is version 140 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again