Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O04130 (SERA2_ARATH)

Entry version 168 (12 Aug 2020)
Sequence version 2 (01 Jan 1998)
Previous versions | rss
Add a publicationFeedback
Protein

D-3-phosphoglycerate dehydrogenase 2, chloroplastic

Gene

PGDH2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the plastidial phosphorylated pathway of serine biosynthesis (PPSB).3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by 90 µM 3-phosphonooxypyruvate, but not by Ser, Thr, Val, Gly Trp, O-acetyl-L-Ser and Cys.2 Publications

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=1.926 mM for 3-phospho-D-glycerate (at pH 7.2)2 Publications
  2. KM=0.899 mM for 3-phospho-D-glycerate (at pH 8.1)2 Publications
  3. KM=1.19 mM for 3-phospho-D-glycerate (at pH 9.0)2 Publications
  4. KM=0.271 mM for NAD+ (at pH 7.2)2 Publications
  5. KM=0.189 mM for NAD+ (at pH 8.1)2 Publications
  6. KM=0.01 mM for NAD+ (at pH 9.0)2 Publications
  7. KM=0.35 mM for 3-phosphonooxypyruvate (at pH 7.1)2 Publications
  8. KM=0.12 mM for NADH (at pH 7.1)2 Publications
  1. Vmax=133 µmol/min/mg enzyme (at pH 8.1)2 Publications
  2. Vmax=108 µmol/min/mg enzyme (at pH 7.2)2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: L-serine biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes L-serine from 3-phospho-D-glycerate.
Proteins known to be involved in the 3 steps of the subpathway in this organism are:
  1. D-3-phosphoglycerate dehydrogenase 2, chloroplastic (PGDH2), D-3-phosphoglycerate dehydrogenase (AXX17_At3g20680), D-3-phosphoglycerate dehydrogenase 1, chloroplastic (PGDH1), D-3-phosphoglycerate dehydrogenase 3, chloroplastic (PGDH3), D-3-phosphoglycerate dehydrogenase (AXX17_At1g18640), D-3-phosphoglycerate dehydrogenase (AXX17_At4g39120), D-3-phosphoglycerate dehydrogenase (AN1_LOCUS13364)
  2. Phosphoserine aminotransferase 1, chloroplastic (PSAT1), Phosphoserine aminotransferase (AXX17_At2g12910), Phosphoserine aminotransferase (AXX17_At4g40680), Phosphoserine transaminase (AN1_LOCUS8117), Phosphoserine transaminase (C24_LOCUS7963), Phosphoserine aminotransferase 2, chloroplastic (PSAT2)
  3. Phosphoserine phosphatase, chloroplastic (PSP), O-phosphoserine phosphohydrolase (AXX17_At1g19560), O-phosphoserine phosphohydrolase (PSP), O-phosphoserine phosphohydrolase (AN1_LOCUS1998)
This subpathway is part of the pathway L-serine biosynthesis, which is itself part of Amino-acid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes L-serine from 3-phospho-D-glycerate, the pathway L-serine biosynthesis and in Amino-acid biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei251NADBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei312By similarity1
Binding sitei336NADBy similarity1
Active sitei341By similarity1
Active sitei360Proton donorBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi231 – 232NADBy similarity2
Nucleotide bindingi310 – 312NADBy similarity3
Nucleotide bindingi360 – 363NADBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processAmino-acid biosynthesis, Serine biosynthesis
LigandNAD

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		ARA:AT1G17745-MONOMER
MetaCyc:AT1G17745-MONOMER

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		O04130

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00135;UER00196

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
D-3-phosphoglycerate dehydrogenase 2, chloroplastic (EC:1.1.1.952 Publications)
Short name:
PGDH
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PGDH2
Synonyms:3-PGDH, PGDH
Ordered Locus Names:At1g17745
ORF Names:F11A6.8
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliopsida › eudicotyledons › Gunneridae › Pentapetalae › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Arabidopsis Information Portal

More...Araporti		AT1G17745

The Arabidopsis Information Resource

More...TAIRi		locus:505006128, AT1G17745

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chloroplast, Plastid

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

No visible phenotype.2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 49ChloroplastSequence analysisAdd BLAST49
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000719250 – 624D-3-phosphoglycerate dehydrogenase 2, chloroplasticAdd BLAST575

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei71PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O04130

PRoteomics IDEntifications database

More...PRIDEi		O04130

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		232830 [O04130-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O04130

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous, but highly expressed in roots and in dark-grown leaf tissues. Expressed in the vasculature, stigma, anther filaments and shoot apical meristem. Not detected in the root meristem or in embryo.3 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Not regulated by high CO2 levels. Up-regulated upon necrotrophic pathogen infection.1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O04130, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O04130, AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		23591, 1 interactor

Protein interaction database and analysis system

More...IntActi		O04130, 1 interactor

STRING: functional protein association networks

More...STRINGi		3702.AT1G17745.2

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O04130

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini552 – 624ACTPROSITE-ProRule annotationAdd BLAST73

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0068, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_019796_8_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O04130

KEGG Orthology (KO)

More...KOi		K00058

Identification of Orthologs from Complete Genome Data

More...OMAi		EAIMAIG

Database of Orthologous Groups

More...OrthoDBi		911009at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O04130

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.1330.90, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002912, ACT_dom
IPR029009, ASB_dom_sf
IPR006139, D-isomer_2_OHA_DH_cat_dom
IPR029753, D-isomer_DH_CS
IPR029752, D-isomer_DH_CS1
IPR006140, D-isomer_DH_NAD-bd
IPR036291, NAD(P)-bd_dom_sf
IPR006236, PGDH

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00389, 2-Hacid_dh, 1 hit
PF02826, 2-Hacid_dh_C, 1 hit
PF01842, ACT, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF143548, SSF143548, 1 hit
SSF51735, SSF51735, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR01327, PGDH, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51671, ACT, 1 hit
PS00065, D_2_HYDROXYACID_DH_1, 1 hit
PS00670, D_2_HYDROXYACID_DH_2, 1 hit
PS00671, D_2_HYDROXYACID_DH_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O04130-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAFSSSCSSV KAVNSRWTSP SPSPSSRFAV LPAFLHRRYA TSVKLTAISA 
        60         70         80         90        100
ALKTVEQTTL TEDNRFSTVG SDSDEYNPTL PKPRILVTEK LGEAGVNLLR 
       110        120        130        140        150
EFGDVDCSYD LSPEDLKKKV AESDALIVRS GTKVTREVFE AAKGRLKVVG 
       160        170        180        190        200
RAGVGIDNVD LQAATEHGCL VVNAPTANTV AAAEHGIALL ASMARNVAQA 
       210        220        230        240        250
DASIKAGKWE RSKYVGVSLV GKTLAVMGFG KVGTEVARRA KGLGMTVISH 
       260        270        280        290        300
DPYAPADRAR ALGVDLVSFD QAISTADFVS LHMPLTPATK KVFNDETFSK 
       310        320        330        340        350
MKKGVRLINV ARGGVIDEDA LVRALDAGIV AQAALDVFCE EPPSKDSRLI 
       360        370        380        390        400
QHENVTVTPH LGASTKEAQE GVAIEIAEAV AGALKGELSA TAVNAPMVAP 
       410        420        430        440        450
EVLSELTPYI VLAEKLGRLA VQLASGGKGV QSIRVVYRSA RDRDDLDTRL 
       460        470        480        490        500
LRAMITKGII EPISDSYVNL VNADFIAKQK GLRISEERMV VDSSPEYPVD 
       510        520        530        540        550
SIQVQILNVE SNFAGAVSDA GDISIEGKVK YGVPHLTCVG SFGVDVSLEG 
       560        570        580        590        600
NLILCRQVDQ PGMIGQVGNI LGEQNVNVNF MSVGRTVLRK QAIMAIGVDE 
       610        620 
EPDNKTLERI GGVSAIEEFV FLKL
Length:624
Mass (Da):66,454
Last modified:January 1, 1998 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i724370F870DEA310
GO
Isoform 2 (identifier: O04130-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     208-210: KWE → TLNYLFLVLLLRWNCRQSKHQYTIETETEK

Show »
Length:651
Mass (Da):69,734
Checksum:iE4CFD9F75F74638B
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_055873208 – 210KWE → TLNYLFLVLLLRWNCRQSKH QYTIETETEK in isoform 2. Curated3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB003280 mRNA Translation: BAA20405.1
AB010407 Genomic DNA Translation: BAA24440.1
AC034257 Genomic DNA Translation: AAF99816.1
CP002684 Genomic DNA Translation: AEE29630.1
CP002684 Genomic DNA Translation: AEE29631.1
AY050399 mRNA Translation: AAK91415.1
AY098953 mRNA Translation: AAM19963.1
AY086001 mRNA Translation: AAM63210.1

Protein sequence database of the Protein Information Resource

More...PIRi		T52296

NCBI Reference Sequences

More...RefSeqi		NP_001031061.2, NM_001035984.2 [O04130-2]
NP_564034.1, NM_101636.3 [O04130-1]

Genome annotation databases

Ensembl plant genome annotation project

More...EnsemblPlantsi		AT1G17745.1; AT1G17745.1; AT1G17745 [O04130-1]
AT1G17745.2; AT1G17745.2; AT1G17745 [O04130-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		838352

Gramene; a comparative resource for plants

More...Gramenei		AT1G17745.1; AT1G17745.1; AT1G17745 [O04130-1]
AT1G17745.2; AT1G17745.2; AT1G17745 [O04130-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		ath:AT1G17745

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB003280 mRNA Translation: BAA20405.1
AB010407 Genomic DNA Translation: BAA24440.1
AC034257 Genomic DNA Translation: AAF99816.1
CP002684 Genomic DNA Translation: AEE29630.1
CP002684 Genomic DNA Translation: AEE29631.1
AY050399 mRNA Translation: AAK91415.1
AY098953 mRNA Translation: AAM19963.1
AY086001 mRNA Translation: AAM63210.1
PIRiT52296
RefSeqiNP_001031061.2, NM_001035984.2 [O04130-2]
NP_564034.1, NM_101636.3 [O04130-1]

3D structure databases

SMRiO04130
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi23591, 1 interactor
IntActiO04130, 1 interactor
STRINGi3702.AT1G17745.2

PTM databases

iPTMnetiO04130

Proteomic databases

PaxDbiO04130
PRIDEiO04130
ProteomicsDBi232830 [O04130-1]

Genome annotation databases

EnsemblPlantsiAT1G17745.1; AT1G17745.1; AT1G17745 [O04130-1]
AT1G17745.2; AT1G17745.2; AT1G17745 [O04130-2]
GeneIDi838352
GrameneiAT1G17745.1; AT1G17745.1; AT1G17745 [O04130-1]
AT1G17745.2; AT1G17745.2; AT1G17745 [O04130-2]
KEGGiath:AT1G17745

Organism-specific databases

AraportiAT1G17745
TAIRilocus:505006128, AT1G17745

Phylogenomic databases

eggNOGiKOG0068, Eukaryota
HOGENOMiCLU_019796_8_1_1
InParanoidiO04130
KOiK00058
OMAiEAIMAIG
OrthoDBi911009at2759
PhylomeDBiO04130

Enzyme and pathway databases

UniPathwayiUPA00135;UER00196
BioCyciARA:AT1G17745-MONOMER
MetaCyc:AT1G17745-MONOMER
SABIO-RKiO04130

Miscellaneous databases

Protein Ontology

More...PROi		PR:O04130

Gene expression databases

ExpressionAtlasiO04130, baseline and differential
GenevisibleiO04130, AT

Family and domain databases

Gene3Di3.30.1330.90, 1 hit
InterProiView protein in InterPro
IPR002912, ACT_dom
IPR029009, ASB_dom_sf
IPR006139, D-isomer_2_OHA_DH_cat_dom
IPR029753, D-isomer_DH_CS
IPR029752, D-isomer_DH_CS1
IPR006140, D-isomer_DH_NAD-bd
IPR036291, NAD(P)-bd_dom_sf
IPR006236, PGDH
PfamiView protein in Pfam
PF00389, 2-Hacid_dh, 1 hit
PF02826, 2-Hacid_dh_C, 1 hit
PF01842, ACT, 1 hit
SUPFAMiSSF143548, SSF143548, 1 hit
SSF51735, SSF51735, 1 hit
TIGRFAMsiTIGR01327, PGDH, 1 hit
PROSITEiView protein in PROSITE
PS51671, ACT, 1 hit
PS00065, D_2_HYDROXYACID_DH_1, 1 hit
PS00670, D_2_HYDROXYACID_DH_2, 1 hit
PS00671, D_2_HYDROXYACID_DH_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSERA2_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O04130
Secondary accession number(s): F4I918
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 1, 1998
Last modified: August 12, 2020
This is version 168 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again