Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O00748 (EST2_HUMAN)

Entry version 155 (08 May 2019)
Sequence version 1 (01 Jul 1997)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Cocaine esterase

Gene

CES2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs (PubMed:9169443). Shows high catalytic efficiency for hydrolysis of cocaine, 4-methylumbelliferyl acetate, heroin and 6-monoacetylmorphine (PubMed:9169443). Hydrolyzes aspirin, substrates with large alcohol group and small acyl group and endogenous lipids such as triacylglycerol (PubMed:28677105).1 Publication1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.39 mM for cocaine1 Publication
  2. KM=0.15 mM for 4-methylumbelliferyl acetate1 Publication
  3. KM=6.8 mM for heroin1 Publication
  4. KM=0.13 mM for 6-monoacetylmorphine1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei228Acyl-ester intermediatePROSITE-ProRule annotation1
    Active sitei345Charge relay systemBy similarity1
    Active sitei457Charge relay systemBy similarity1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    View the complete GO annotation on QuickGO ...

    GO - Biological processi

    View the complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionHydrolase, Serine esterase

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...    BRENDAi    		3.1.1.1 2681
    3.1.1.84 2681

    Reactome - a knowledgebase of biological pathways and processes

    More...    Reactomei    		R-HSA-211945 Phase I - Functionalization of compounds

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...    SABIO-RKi    		O00748

    Protein family/group databases

    ESTHER database of the Alpha/Beta-hydrolase fold superfamily of proteins

    More...    ESTHERi    		human-CES2 Carb_B_Chordata

    MEROPS protease database

    More...    MEROPSi    		S09.984

    Chemistry databases

    SwissLipids knowledge resource for lipid biology

    More...    SwissLipidsi    		SLP:000001424

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Cocaine esterase (EC:3.1.1.84)
    Alternative name(s):
    Carboxylesterase 2 (EC:3.1.1.1)
    Short name:
    CE-2
    Short name:
    hCE-2
    Methylumbelliferyl-acetate deacetylase 2 (EC:3.1.1.56)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:CES2
    Synonyms:ICE
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

    Organism-specific databases

    Human Gene Nomenclature Database

    More...    HGNCi    		HGNC:1864 CES2

    Online Mendelian Inheritance in Man (OMIM)

    More...    MIMi    		605278 gene

    neXtProt; the human protein knowledge platform

    More...    neXtProti    		NX_O00748

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Endoplasmic reticulum

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Organism-specific databases

    DisGeNET

    More...    DisGeNETi    		8824

    Open Targets

    More...    OpenTargetsi    		ENSG00000172831

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...    PharmGKBi    		PA377

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...    ChEMBLi    		CHEMBL3180

    Drug and drug target database

    More...    DrugBanki    		DB06695 Dabigatran etexilate
    DB00762 Irinotecan
    DB00688 Mycophenolate mofetil
    DB06209 Prasugrel

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...    BioMutai    		CES2

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 261 PublicationAdd BLAST26
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000857227 – 559Cocaine esteraseAdd BLAST533

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei27Pyrrolidone carboxylic acidBy similarity1
    <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi95 ↔ 123By similarity
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi111N-linked (GlcNAc...) asparagine1 Publication1
    Glycosylationi276N-linked (GlcNAc...) asparagineSequence analysis1
    Disulfide bondi280 ↔ 291By similarity

    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

    Glycosylated.2 Publications

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Pyrrolidone carboxylic acid

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...    EPDi    		O00748

    jPOST - Japan Proteome Standard Repository/Database

    More...    jPOSTi    		O00748

    MaxQB - The MaxQuant DataBase

    More...    MaxQBi    		O00748

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		O00748

    PeptideAtlas

    More...    PeptideAtlasi    		O00748

    PRoteomics IDEntifications database

    More...    PRIDEi    		O00748

    ProteomicsDB human proteome resource

    More...    ProteomicsDBi    		48014
    48015 [O00748-2]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		O00748

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		O00748

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Preferentially expressed in intestine with moderate expression in liver. Within the intestine, highest expression is found in small intestine with lower expression in colon and rectum.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSG00000172831 Expressed in 236 organ(s), highest expression level in jejunal mucosa

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		O00748 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		O00748 HS

    Organism-specific databases

    Human Protein Atlas

    More...    HPAi    		HPA018897

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Monomer.1 Publication

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...    BioGridi    		114351, 1 interactor

    Protein interaction database and analysis system

    More...    IntActi    		O00748, 2 interactors

    STRING: functional protein association networks

    More...    STRINGi    		9606.ENSP00000317842

    Chemistry databases

    BindingDB database of measured binding affinities

    More...    BindingDBi    		O00748

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		O00748

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Motif

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi556 – 559Prevents secretion from ERSequence analysis4

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the type-B carboxylesterase/lipase family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG1516 Eukaryota
    COG2272 LUCA

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00940000153793

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...    HOGENOMi    		HOG000091866

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		O00748

    KEGG Orthology (KO)

    More...    KOi    		K03927

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		LVETECG

    Database of Orthologous Groups

    More...    OrthoDBi    		754103at2759

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		O00748

    TreeFam database of animal gene trees

    More...    TreeFami    		TF315470

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...    Gene3Di    		3.40.50.1820, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR029058 AB_hydrolase
    IPR002018 CarbesteraseB
    IPR019826 Carboxylesterase_B_AS
    IPR019819 Carboxylesterase_B_CS

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF00135 COesterase, 1 hit

    Superfamily database of structural and functional annotation

    More...    SUPFAMi    		SSF53474 SSF53474, 1 hit

    PROSITE; a protein domain and family database

    More...    PROSITEi    		View protein in PROSITE
    PS00122 CARBOXYLESTERASE_B_1, 1 hit
    PS00941 CARBOXYLESTERASE_B_2, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

    This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: O00748-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MRLHRLRARL SAVACGLLLL LVRGQGQDSA SPIRTTHTGQ VLGSLVHVKG 
            60         70         80         90        100
    ANAGVQTFLG IPFAKPPLGP LRFAPPEPPE SWSGVRDGTT HPAMCLQDLT 
           110        120        130        140        150
    AVESEFLSQF NMTFPSDSMS EDCLYLSIYT PAHSHEGSNL PVMVWIHGGA 
           160        170        180        190        200
    LVFGMASLYD GSMLAALENV VVVIIQYRLG VLGFFSTGDK HATGNWGYLD 
           210        220        230        240        250
    QVAALRWVQQ NIAHFGGNPD RVTIFGESAG GTSVSSLVVS PISQGLFHGA 
           260        270        280        290        300
    IMESGVALLP GLIASSADVI STVVANLSAC DQVDSEALVG CLRGKSKEEI 
           310        320        330        340        350
    LAINKPFKMI PGVVDGVFLP RHPQELLASA DFQPVPSIVG VNNNEFGWLI 
           360        370        380        390        400
    PKVMRIYDTQ KEMDREASQA ALQKMLTLLM LPPTFGDLLR EEYIGDNGDP 
           410        420        430        440        450
    QTLQAQFQEM MADSMFVIPA LQVAHFQCSR APVYFYEFQH QPSWLKNIRP 
           460        470        480        490        500
    PHMKADHGDE LPFVFRSFFG GNYIKFTEEE EQLSRKMMKY WANFARNGNP 
           510        520        530        540        550
    NGEGLPHWPL FDQEEQYLQL NLQPAVGRAL KAHRLQFWKK ALPQKIQELE 

    EPEERHTEL
    Length:559
    Mass (Da):61,807
    Last modified:July 1, 1997 - v1
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE2EBCABA2995339A
    GO
    Isoform 2 (identifier: O00748-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         458-474: GDELPFVFRSFFGGNYI → V

    Show »
    Length:543
    Mass (Da):59,959
    Checksum:i4F14FE06766F0F7E
    GO
    Isoform 3 (identifier: O00748-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTETSEPTM

    Note: Probably produced by alternative initiation of isoform 1. Does not contain a signal peptide. The biological function of the extra amino acids in the N-terminus remains to be determined.1 Publication
    Show »
    Length:623
    Mass (Da):68,899
    Checksum:i5220B2965D800EA3
    GO
    Isoform 4 (identifier: O00748-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTETSEPTM
         458-474: GDELPFVFRSFFGGNYI → V

    Note: Probably produced by alternative initiation of isoform 2. Does not contain a signal peptide. The biological function of the extra amino acids in the N-terminus remains to be determined.1 Publication
    Show »
    Length:607
    Mass (Da):67,051
    Checksum:i7FF4E1A2227B6F9C
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    		Gene namesLengthAnnotation
    J3QLP1J3QLP1_HUMAN
    Cocaine esterase
    CES2
    		125Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    J3QSC0J3QSC0_HUMAN
    Cocaine esterase
    CES2
    		201Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H3BUN5H3BUN5_HUMAN
    Cocaine esterase
    CES2
    		122Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    J3QKN7J3QKN7_HUMAN
    Cocaine esterase
    CES2
    		21Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2 – 10Missing AA sequence (PubMed:9169443).Curated9
    Sequence conflicti180G → S in BAF83171 (PubMed:14702039).Curated1
    Sequence conflicti239V → M in BAF83171 (PubMed:14702039).Curated1
    Sequence conflicti385F → S in CAD98009 (PubMed:17974005).Curated1
    Sequence conflicti519Q → R in CAD98009 (PubMed:17974005).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01839634R → W1 Publication1
    Natural variantiVAR_018397206R → H1 Publication1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0598041M → MTAQSRSPTTPTFPGPSQRT PLTPCPVQTPRLGKALIHCW TDPGQPLGEQQRVRRQRTET SEPTM in isoform 3 and isoform 4. 1 Publication1
    Alternative sequenceiVSP_010161458 – 474GDELP…GGNYI → V in isoform 2 and isoform 4. 1 PublicationAdd BLAST17

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		Y09616 mRNA Translation: CAA70831.1
    D50579 mRNA Translation: BAA23606.1
    U60553 mRNA Translation: AAB03611.1
    AL713761 mRNA Translation: CAD28531.1
    AK290482 mRNA Translation: BAF83171.1
    BX538086 mRNA Translation: CAD98009.1
    AY851164 Genomic DNA Translation: AAW29943.1
    AC009084 Genomic DNA No translation available.
    CH471092 Genomic DNA Translation: EAW83058.1
    CH471092 Genomic DNA Translation: EAW83059.1
    BC032095 mRNA Translation: AAH32095.1

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS10825.1 [O00748-1]
    CCDS45507.1 [O00748-2]

    Protein sequence database of the Protein Information Resource

    More...    PIRi    		JC5408

    NCBI Reference Sequences

    More...    RefSeqi    		NP_003860.2, NM_003869.5 [O00748-1]
    NP_932327.1, NM_198061.2 [O00748-2]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENST00000317091; ENSP00000317842; ENSG00000172831 [O00748-4]
    ENST00000417689; ENSP00000394452; ENSG00000172831 [O00748-5]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		8824

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		hsa:8824

    UCSC genome browser

    More...    UCSCi    		uc002eqq.4 human [O00748-1]
    uc002eqr.4 human

    Keywords - Coding sequence diversityi

    Alternative initiation, Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    <p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		Y09616 mRNA Translation: CAA70831.1
    D50579 mRNA Translation: BAA23606.1
    U60553 mRNA Translation: AAB03611.1
    AL713761 mRNA Translation: CAD28531.1
    AK290482 mRNA Translation: BAF83171.1
    BX538086 mRNA Translation: CAD98009.1
    AY851164 Genomic DNA Translation: AAW29943.1
    AC009084 Genomic DNA No translation available.
    CH471092 Genomic DNA Translation: EAW83058.1
    CH471092 Genomic DNA Translation: EAW83059.1
    BC032095 mRNA Translation: AAH32095.1
    CCDSiCCDS10825.1 [O00748-1]
    CCDS45507.1 [O00748-2]
    PIRiJC5408
    RefSeqiNP_003860.2, NM_003869.5 [O00748-1]
    NP_932327.1, NM_198061.2 [O00748-2]

    3D structure databases

    SMRiO00748
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi114351, 1 interactor
    IntActiO00748, 2 interactors
    STRINGi9606.ENSP00000317842

    Chemistry databases

    BindingDBiO00748
    ChEMBLiCHEMBL3180
    DrugBankiDB06695 Dabigatran etexilate
    DB00762 Irinotecan
    DB00688 Mycophenolate mofetil
    DB06209 Prasugrel
    SwissLipidsiSLP:000001424

    Protein family/group databases

    ESTHERihuman-CES2 Carb_B_Chordata
    MEROPSiS09.984

    PTM databases

    iPTMnetiO00748
    PhosphoSitePlusiO00748

    Polymorphism and mutation databases

    BioMutaiCES2

    Proteomic databases

    EPDiO00748
    jPOSTiO00748
    MaxQBiO00748
    PaxDbiO00748
    PeptideAtlasiO00748
    PRIDEiO00748
    ProteomicsDBi48014
    48015 [O00748-2]

    Protocols and materials databases

    The DNASU plasmid repository

    More...    DNASUi    		8824
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000317091; ENSP00000317842; ENSG00000172831 [O00748-4]
    ENST00000417689; ENSP00000394452; ENSG00000172831 [O00748-5]
    GeneIDi8824
    KEGGihsa:8824
    UCSCiuc002eqq.4 human [O00748-1]
    uc002eqr.4 human

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		8824
    DisGeNETi8824

    GeneCards: human genes, protein and diseases

    More...    GeneCardsi    		CES2
    HGNCiHGNC:1864 CES2
    HPAiHPA018897
    MIMi605278 gene
    neXtProtiNX_O00748
    OpenTargetsiENSG00000172831
    PharmGKBiPA377

    GenAtlas: human gene database

    More...    GenAtlasi    		Search...

    Phylogenomic databases

    eggNOGiKOG1516 Eukaryota
    COG2272 LUCA
    GeneTreeiENSGT00940000153793
    HOGENOMiHOG000091866
    InParanoidiO00748
    KOiK03927
    OMAiLVETECG
    OrthoDBi754103at2759
    PhylomeDBiO00748
    TreeFamiTF315470

    Enzyme and pathway databases

    BRENDAi3.1.1.1 2681
    3.1.1.84 2681
    ReactomeiR-HSA-211945 Phase I - Functionalization of compounds
    SABIO-RKiO00748

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...    ChiTaRSi    		CES2 human

    The Gene Wiki collection of pages on human genes and proteins

    More...    GeneWikii    		Carboxylesterase_2

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...    GenomeRNAii    		8824

    Protein Ontology

    More...    PROi    		PR:O00748

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSG00000172831 Expressed in 236 organ(s), highest expression level in jejunal mucosa
    ExpressionAtlasiO00748 baseline and differential
    GenevisibleiO00748 HS

    Family and domain databases

    Gene3Di3.40.50.1820, 1 hit
    InterProiView protein in InterPro
    IPR029058 AB_hydrolase
    IPR002018 CarbesteraseB
    IPR019826 Carboxylesterase_B_AS
    IPR019819 Carboxylesterase_B_CS
    PfamiView protein in Pfam
    PF00135 COesterase, 1 hit
    SUPFAMiSSF53474 SSF53474, 1 hit
    PROSITEiView protein in PROSITE
    PS00122 CARBOXYLESTERASE_B_1, 1 hit
    PS00941 CARBOXYLESTERASE_B_2, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...    ProtoNeti    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEST2_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00748
    Secondary accession number(s): A0A024R6X1
    , A8K367, Q16859, Q5MAB8, Q7Z366, Q8IUP4, Q8TCP8
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
    Last sequence update: July 1, 1997
    Last modified: May 8, 2019
    This is version 155 of the entry and version 1 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again