Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - O00748 (EST2_HUMAN)

Entry version 171 (23 Feb 2022)
Sequence version 1 (01 Jul 1997)
Previous versions | rss
Add a publicationFeedback
Protein

Cocaine esterase

Gene

CES2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs (PubMed:9169443).

Shows high catalytic efficiency for hydrolysis of cocaine, 4-methylumbelliferyl acetate, heroin and 6-monoacetylmorphine (PubMed:9169443).

Hydrolyzes aspirin, substrates with large alcohol group and small acyl group and endogenous lipids such as triacylglycerol (PubMed:28677105).

Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes of 2-arachidonoylglycerol and prostaglandins (PubMed:21049984).

1 Publication2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

kcat is 43 min(-1), 49 min(-1), 150 min(-1) with 2-arachidonoylglycerol, prostaglandin F2alpha 1-glyceryl ester and prostaglandin E2 1-glyceryl ester as substrates, respectively.1 Publication
  1. KM=0.39 mM for cocaine1 Publication
  2. KM=0.15 mM for 4-methylumbelliferyl acetate1 Publication
  3. KM=6.8 mM for heroin1 Publication
  4. KM=46 µM for 2-arachidonoylglycerol1 Publication
  5. KM=750 µM for prostaglandin E2 1-glyceryl ester1 Publication
  6. KM=35 µM for prostaglandin F2alpha 1-glyceryl ester1 Publication
  7. KM=0.13 mM for 6-monoacetylmorphine1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei228Acyl-ester intermediatePROSITE-ProRule annotation1
Active sitei345Charge relay systemBy similarity1
Active sitei457Charge relay systemBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Serine esterase
Biological processLipid metabolism

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.1.1.1, 2681
3.1.1.84, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O00748

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-211945, Phase I - Functionalization of compounds

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		O00748

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O00748

Protein family/group databases

ESTHER database of the Alpha/Beta-hydrolase fold superfamily of proteins

More...ESTHERi		human-CES2, Carb_B_Chordata

MEROPS protease database

More...MEROPSi		S09.984

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001424

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cocaine esteraseCurated (EC:3.1.1.841 Publication)
Alternative name(s):
Carboxylesterase 2 (EC:3.1.1.11 Publication)
Short name:
CE-2
Short name:
hCE-2
Methylumbelliferyl-acetate deacetylase 2 (EC:3.1.1.56)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CES2Imported
Synonyms:ICE
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1864, CES2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605278, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O00748

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000172831

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Endoplasmic reticulum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		8824

Open Targets

More...OpenTargetsi		ENSG00000172831

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA377

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O00748, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3180

Drug and drug target database

More...DrugBanki		DB06695, Dabigatran etexilate
DB14845, Filgotinib
DB00762, Irinotecan
DB06209, Prasugrel

DrugCentral

More...DrugCentrali		O00748

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CES2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 261 PublicationAdd BLAST26
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000857227 – 559Cocaine esteraseAdd BLAST533

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei27Pyrrolidone carboxylic acidBy similarity1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi95 ↔ 123By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi111N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi276N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi280 ↔ 291By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Glycosylated.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Pyrrolidone carboxylic acid

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O00748

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O00748

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O00748

MaxQB - The MaxQuant DataBase

More...MaxQBi		O00748

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O00748

PeptideAtlas

More...PeptideAtlasi		O00748

PRoteomics IDEntifications database

More...PRIDEi		O00748

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		48014 [O00748-1]
48015 [O00748-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O00748, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O00748

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O00748

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Preferentially expressed in intestine with moderate expression in liver. Within the intestine, highest expression is found in small intestine with lower expression in colon and rectum.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000172831, Expressed in jejunal mucosa and 249 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O00748, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O00748, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000172831, Tissue enhanced (intestine, liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114351, 26 interactors

Protein interaction database and analysis system

More...IntActi		O00748, 3 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000317842

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		O00748

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O00748, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O00748

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi556 – 559Prevents secretion from ERSequence analysis4

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the type-B carboxylesterase/lipase family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1516, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153793

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_006586_13_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O00748

Identification of Orthologs from Complete Genome Data

More...OMAi		NIANTVC

Database of Orthologous Groups

More...OrthoDBi		754103at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O00748

TreeFam database of animal gene trees

More...TreeFami		TF315470

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.50.1820, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029058, AB_hydrolase
IPR002018, CarbesteraseB
IPR019826, Carboxylesterase_B_AS
IPR019819, Carboxylesterase_B_CS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00135, COesterase, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53474, SSF53474, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00122, CARBOXYLESTERASE_B_1, 1 hit
PS00941, CARBOXYLESTERASE_B_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O00748-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRLHRLRARL SAVACGLLLL LVRGQGQDSA SPIRTTHTGQ VLGSLVHVKG 
        60         70         80         90        100
ANAGVQTFLG IPFAKPPLGP LRFAPPEPPE SWSGVRDGTT HPAMCLQDLT 
       110        120        130        140        150
AVESEFLSQF NMTFPSDSMS EDCLYLSIYT PAHSHEGSNL PVMVWIHGGA 
       160        170        180        190        200
LVFGMASLYD GSMLAALENV VVVIIQYRLG VLGFFSTGDK HATGNWGYLD 
       210        220        230        240        250
QVAALRWVQQ NIAHFGGNPD RVTIFGESAG GTSVSSLVVS PISQGLFHGA 
       260        270        280        290        300
IMESGVALLP GLIASSADVI STVVANLSAC DQVDSEALVG CLRGKSKEEI 
       310        320        330        340        350
LAINKPFKMI PGVVDGVFLP RHPQELLASA DFQPVPSIVG VNNNEFGWLI 
       360        370        380        390        400
PKVMRIYDTQ KEMDREASQA ALQKMLTLLM LPPTFGDLLR EEYIGDNGDP 
       410        420        430        440        450
QTLQAQFQEM MADSMFVIPA LQVAHFQCSR APVYFYEFQH QPSWLKNIRP 
       460        470        480        490        500
PHMKADHGDE LPFVFRSFFG GNYIKFTEEE EQLSRKMMKY WANFARNGNP 
       510        520        530        540        550
NGEGLPHWPL FDQEEQYLQL NLQPAVGRAL KAHRLQFWKK ALPQKIQELE 

EPEERHTEL
Length:559
Mass (Da):61,807
Last modified:July 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE2EBCABA2995339A
GO
Isoform 2 (identifier: O00748-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     458-474: GDELPFVFRSFFGGNYI → V

Show »
Length:543
Mass (Da):59,959
Checksum:i4F14FE06766F0F7E
GO
Isoform 3 (identifier: O00748-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTETSEPTM

Note: Probably produced by alternative initiation of isoform 1. Does not contain a signal peptide. The biological function of the extra amino acids in the N-terminus remains to be determined.1 Publication
Show »
Length:623
Mass (Da):68,899
Checksum:i5220B2965D800EA3
GO
Isoform 4 (identifier: O00748-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTETSEPTM
     458-474: GDELPFVFRSFFGGNYI → V

Note: Probably produced by alternative initiation of isoform 2. Does not contain a signal peptide. The biological function of the extra amino acids in the N-terminus remains to be determined.1 Publication
Show »
Length:607
Mass (Da):67,051
Checksum:i7FF4E1A2227B6F9C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BUN5H3BUN5_HUMAN
Cocaine esterase
CES2
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLP1J3QLP1_HUMAN
Cocaine esterase
CES2
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QSC0J3QSC0_HUMAN
Cocaine esterase
CES2
201Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2 – 10Missing AA sequence (PubMed:9169443).Curated9
Sequence conflicti180G → S in BAF83171 (PubMed:14702039).Curated1
Sequence conflicti239V → M in BAF83171 (PubMed:14702039).Curated1
Sequence conflicti385F → S in CAD98009 (PubMed:17974005).Curated1
Sequence conflicti519Q → R in CAD98009 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01839634R → W1 PublicationCorresponds to variant dbSNP:rs72547531Ensembl.1
Natural variantiVAR_018397206R → H1 PublicationCorresponds to variant dbSNP:rs8192924Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0598041M → MTAQSRSPTTPTFPGPSQRT PLTPCPVQTPRLGKALIHCW TDPGQPLGEQQRVRRQRTET SEPTM in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_010161458 – 474GDELP…GGNYI → V in isoform 2 and isoform 4. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y09616 mRNA Translation: CAA70831.1
D50579 mRNA Translation: BAA23606.1
U60553 mRNA Translation: AAB03611.1
AL713761 mRNA Translation: CAD28531.1
AK290482 mRNA Translation: BAF83171.1
BX538086 mRNA Translation: CAD98009.1
AY851164 Genomic DNA Translation: AAW29943.1
AC009084 Genomic DNA No translation available.
CH471092 Genomic DNA Translation: EAW83058.1
CH471092 Genomic DNA Translation: EAW83059.1
BC032095 mRNA Translation: AAH32095.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10825.1 [O00748-1]
CCDS45507.1 [O00748-2]

Protein sequence database of the Protein Information Resource

More...PIRi		JC5408

NCBI Reference Sequences

More...RefSeqi		NP_003860.2, NM_003869.5 [O00748-1]
NP_932327.1, NM_198061.2 [O00748-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000317091; ENSP00000317842; ENSG00000172831
ENST00000417689; ENSP00000394452; ENSG00000172831 [O00748-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8824

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8824

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000317091.10; ENSP00000317842.5; NM_001365405.1; NP_001352334.1

UCSC genome browser

More...UCSCi		uc002eqq.4, human [O00748-1]
uc002eqr.4, human

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y09616 mRNA Translation: CAA70831.1
D50579 mRNA Translation: BAA23606.1
U60553 mRNA Translation: AAB03611.1
AL713761 mRNA Translation: CAD28531.1
AK290482 mRNA Translation: BAF83171.1
BX538086 mRNA Translation: CAD98009.1
AY851164 Genomic DNA Translation: AAW29943.1
AC009084 Genomic DNA No translation available.
CH471092 Genomic DNA Translation: EAW83058.1
CH471092 Genomic DNA Translation: EAW83059.1
BC032095 mRNA Translation: AAH32095.1
CCDSiCCDS10825.1 [O00748-1]
CCDS45507.1 [O00748-2]
PIRiJC5408
RefSeqiNP_003860.2, NM_003869.5 [O00748-1]
NP_932327.1, NM_198061.2 [O00748-2]

3D structure databases

SMRiO00748
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114351, 26 interactors
IntActiO00748, 3 interactors
STRINGi9606.ENSP00000317842

Chemistry databases

BindingDBiO00748
ChEMBLiCHEMBL3180
DrugBankiDB06695, Dabigatran etexilate
DB14845, Filgotinib
DB00762, Irinotecan
DB06209, Prasugrel
DrugCentraliO00748
SwissLipidsiSLP:000001424

Protein family/group databases

ESTHERihuman-CES2, Carb_B_Chordata
MEROPSiS09.984

PTM databases

GlyGeniO00748, 2 sites
iPTMnetiO00748
PhosphoSitePlusiO00748

Genetic variation databases

BioMutaiCES2

Proteomic databases

EPDiO00748
jPOSTiO00748
MassIVEiO00748
MaxQBiO00748
PaxDbiO00748
PeptideAtlasiO00748
PRIDEiO00748
ProteomicsDBi48014 [O00748-1]
48015 [O00748-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		15599, 367 antibodies from 34 providers

The DNASU plasmid repository

More...DNASUi		8824

Genome annotation databases

EnsembliENST00000317091; ENSP00000317842; ENSG00000172831
ENST00000417689; ENSP00000394452; ENSG00000172831 [O00748-2]
GeneIDi8824
KEGGihsa:8824
MANE-SelectiENST00000317091.10; ENSP00000317842.5; NM_001365405.1; NP_001352334.1
UCSCiuc002eqq.4, human [O00748-1]
uc002eqr.4, human

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8824
DisGeNETi8824

GeneCards: human genes, protein and diseases

More...GeneCardsi		CES2
HGNCiHGNC:1864, CES2
HPAiENSG00000172831, Tissue enhanced (intestine, liver)
MIMi605278, gene
neXtProtiNX_O00748
OpenTargetsiENSG00000172831
PharmGKBiPA377
VEuPathDBiHostDB:ENSG00000172831

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1516, Eukaryota
GeneTreeiENSGT00940000153793
HOGENOMiCLU_006586_13_2_1
InParanoidiO00748
OMAiNIANTVC
OrthoDBi754103at2759
PhylomeDBiO00748
TreeFamiTF315470

Enzyme and pathway databases

BRENDAi3.1.1.1, 2681
3.1.1.84, 2681
PathwayCommonsiO00748
ReactomeiR-HSA-211945, Phase I - Functionalization of compounds
SABIO-RKiO00748
SignaLinkiO00748

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8824, 8 hits in 1046 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CES2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Carboxylesterase_2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8824
PharosiO00748, Tchem

Protein Ontology

More...PROi		PR:O00748
RNActiO00748, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000172831, Expressed in jejunal mucosa and 249 other tissues
ExpressionAtlasiO00748, baseline and differential
GenevisibleiO00748, HS

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058, AB_hydrolase
IPR002018, CarbesteraseB
IPR019826, Carboxylesterase_B_AS
IPR019819, Carboxylesterase_B_CS
PfamiView protein in Pfam
PF00135, COesterase, 1 hit
SUPFAMiSSF53474, SSF53474, 1 hit
PROSITEiView protein in PROSITE
PS00122, CARBOXYLESTERASE_B_1, 1 hit
PS00941, CARBOXYLESTERASE_B_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEST2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00748
Secondary accession number(s): A0A024R6X1
, A8K367, Q16859, Q5MAB8, Q7Z366, Q8IUP4, Q8TCP8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: July 1, 1997
Last modified: February 23, 2022
This is version 171 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again