Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear factor 1 B-type

Gene

NFIB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi1 – 195CTF/NF-IPROSITE-ProRule annotationAdd BLAST195

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding
Biological processDNA replication, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-73980 RNA Polymerase III Transcription Termination
R-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation
SignaLinkiO00712
SIGNORiO00712

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor 1 B-type
Short name:
NF1-B
Short name:
Nuclear factor 1/B
Alternative name(s):
CCAAT-box-binding transcription factor
Short name:
CTF
Nuclear factor I/B
Short name:
NF-I/B
Short name:
NFI-B
TGGCA-binding protein
Gene namesi
Name:NFIB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000147862.14
HGNCiHGNC:7785 NFIB
MIMi600728 gene
neXtProtiNX_O00712

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi4781
OpenTargetsiENSG00000147862
PharmGKBiPA31591

Polymorphism and mutation databases

BioMutaiNFIB

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001001951 – 420Nuclear factor 1 B-typeAdd BLAST420

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei264PhosphoserineCombined sources1
Modified residuei286PhosphothreonineBy similarity1
Modified residuei292PhosphoserineCombined sources1
Modified residuei295PhosphoserineCombined sources1
Modified residuei312PhosphoserineCombined sources1
Modified residuei328PhosphoserineCombined sources1
Modified residuei333PhosphoserineCombined sources1
Modified residuei335Asymmetric dimethylarginineBy similarity1
Modified residuei388Asymmetric dimethylarginineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiO00712
PaxDbiO00712
PeptideAtlasiO00712
PRIDEiO00712
ProteomicsDBi48006
48007 [O00712-2]

PTM databases

iPTMnetiO00712
PhosphoSitePlusiO00712

Expressioni

Gene expression databases

BgeeiENSG00000147862 Expressed in 249 organ(s), highest expression level in cerebral cortex
CleanExiHS_NFIB
ExpressionAtlasiO00712 baseline and differential
GenevisibleiO00712 HS

Organism-specific databases

HPAiHPA003956

Interactioni

Subunit structurei

Binds DNA as a homodimer.

Protein-protein interaction databases

BioGridi110853, 15 interactors
DIPiDIP-61433N
IntActiO00712, 6 interactors
STRINGi9606.ENSP00000370340

Structurei

3D structure databases

ProteinModelPortaliO00712
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CTF/NF-I family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3663 Eukaryota
ENOG410Y16G LUCA
GeneTreeiENSGT00390000009905
HOGENOMiHOG000013028
HOVERGENiHBG006561
InParanoidiO00712
KOiK09169
PhylomeDBiO00712
TreeFamiTF313889

Family and domain databases

InterProiView protein in InterPro
IPR000647 CTF/NFI
IPR020604 CTF/NFI_DNA-bd-dom
IPR019739 CTF/NFI_DNA-bd_CS
IPR019548 CTF/NFI_DNA-bd_N
IPR003619 MAD_homology1_Dwarfin-type
PANTHERiPTHR11492 PTHR11492, 1 hit
PfamiView protein in Pfam
PF00859 CTF_NFI, 1 hit
PF03165 MH1, 1 hit
PF10524 NfI_DNAbd_pre-N, 1 hit
SMARTiView protein in SMART
SM00523 DWA, 1 hit
PROSITEiView protein in PROSITE
PS00349 CTF_NFI_1, 1 hit
PS51080 CTF_NFI_2, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 6 described isoforms and 17 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O00712-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMYSPICLTQ DEFHPFIEAL LPHVRAIAYT WFNLQARKRK YFKKHEKRMS
60 70 80 90 100
KDEERAVKDE LLSEKPEIKQ KWASRLLAKL RKDIRQEYRE DFVLTVTGKK
110 120 130 140 150
HPCCVLSNPD QKGKIRRIDC LRQADKVWRL DLVMVILFKG IPLESTDGER
160 170 180 190 200
LMKSPHCTNP ALCVQPHHIT VSVKELDLFL AYYVQEQDSG QSGSPSHNDP
210 220 230 240 250
AKNPPGYLED SFVKSGVFNV SELVRVSRTP ITQGTGVNFP IGEIPSQPYY
260 270 280 290 300
HDMNSGVNLQ RSLSSPPSSK RPKTISIDEN MEPSPTGDFY PSPSSPAAGS
310 320 330 340 350
RTWHERDQDM SSPTTMKKPE KPLFSSASPQ DSSPRLSTFP QHHHPGIPGV
360 370 380 390 400
AHSVISTRTP PPPSPLPFPT QAILPPAPSS YFSHPTIRYP PHLNPQDTLK
410 420
NYVPSYDPSS PQTSQSWYLG
Length:420
Mass (Da):47,442
Last modified:March 15, 2004 - v2
Checksum:i0F71635FE9D64FA4
GO
Isoform 2 (identifier: O00712-3)
Sequence is not available
Length:
Mass (Da):
Isoform 3 (identifier: O00712-2) [UniParc]FASTAAdd to basket
Also known as: NFI-B3

The sequence of this isoform differs from the canonical sequence as follows:
     187-188: QD → AR
     189-420: Missing.

Show »
Length:188
Mass (Da):22,251
Checksum:iC718698597C13336
GO
Isoform 4 (identifier: O00712-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MMYSPICLTQ → MERIPVSVDFWVVCCAVLKCNPGIPMERIPVSVDFWVVCCAVLKCNPGIPKRMSTLCFGFS

Note: No experimental confirmation available.
Show »
Length:471
Mass (Da):53,049
Checksum:iD2797FFB1527C066
GO
Isoform 5 (identifier: O00712-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     416-416: S → PNGSGQVVGK...DPSFLHQQQS

Note: No experimental confirmation available.
Show »
Length:494
Mass (Da):55,181
Checksum:i55BE3377EEEA2C07
GO
Isoform 6 (identifier: O00712-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-252: Missing.
     416-420: SWYLG → PNGSGQVVGK...EPFLQAETSN

Note: No experimental confirmation available.
Show »
Length:309
Mass (Da):33,525
Checksum:i8DA70FF7F8A8CEEF
GO

Computationally mapped potential isoform sequencesi

There are 17 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5VW26Q5VW26_HUMAN
Nuclear factor 1
NFIB hCG_1742080
570Annotation score:
Q5VW30Q5VW30_HUMAN
Nuclear factor 1
NFIB hCG_1742080
561Annotation score:
Q5VW27Q5VW27_HUMAN
Nuclear factor 1
NFIB hCG_1742080
487Annotation score:
A0A0A0MRX8A0A0A0MRX8_HUMAN
Nuclear factor 1
NFIB
446Annotation score:
U3KQE8U3KQE8_HUMAN
Nuclear factor 1
NFIB
416Annotation score:
A0A1B0GWJ4A0A1B0GWJ4_HUMAN
Nuclear factor 1
NFIB
445Annotation score:
A0A1B0GU97A0A1B0GU97_HUMAN
Nuclear factor 1
NFIB
478Annotation score:
A0A1B0GW37A0A1B0GW37_HUMAN
Nuclear factor 1
NFIB
411Annotation score:
A0A1B0GWI9A0A1B0GWI9_HUMAN
Nuclear factor 1
NFIB
480Annotation score:
A0A2R8Y7V8A0A2R8Y7V8_HUMAN
Nuclear factor 1
NFIB
566Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti17I → M in AAB41899 (PubMed:9484777).Curated1
Sequence conflicti37R → G in BAD18416 (PubMed:14702039).Curated1
Sequence conflicti74S → F in BX648845 (PubMed:17974005).Curated1
Sequence conflicti198N → S in BAD18416 (PubMed:14702039).Curated1
Sequence conflicti284S → R in BX648845 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0547131 – 252Missing in isoform 6. 1 PublicationAdd BLAST252
Alternative sequenceiVSP_0444621 – 10MMYSPICLTQ → MERIPVSVDFWVVCCAVLKC NPGIPMERIPVSVDFWVVCC AVLKCNPGIPKRMSTLCFGF S in isoform 4. 1 Publication10
Alternative sequenceiVSP_003545187 – 188QD → AR in isoform 3. 1 Publication2
Alternative sequenceiVSP_003546189 – 420Missing in isoform 3. 1 PublicationAdd BLAST232
Alternative sequenceiVSP_054714416 – 420SWYLG → PNGSGQVVGKVPGHFTPVLA PSPHPSAVRPVTLSMTDTKP ITTSTEAYTASGTSQANRYV GLSPRDPSFLHQQQLRICDW TMNQNGRHLYPSTSEDTLGI TWQSPGTWASLVPFQVSNRT PILPANVQNYGLNIIGEPFL QAETSN in isoform 6. 1 Publication5
Alternative sequenceiVSP_045065416S → PNGSGQVVGKVPGHFTPVLA PSPHPSAVRPVTLSMTDTKP ITTSTEAYTASGTSQANRYV GLSPRDPSFLHQQQS in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U85193 mRNA Translation: AAB41899.1
U70862 mRNA Translation: AAB51197.1
BT007266 mRNA Translation: AAP35930.1
AK131233 mRNA Translation: BAD18416.1
BX648416 mRNA Translation: CAH56156.1
BX648845 mRNA No translation available.
AL136366 Genomic DNA No translation available.
AL441963 Genomic DNA No translation available.
AL137017 Genomic DNA No translation available.
AL449443 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58697.1
CH471071 Genomic DNA Translation: EAW58699.1
BC001283 mRNA Translation: AAH01283.1
U07810 mRNA Translation: AAA93125.1
CCDSiCCDS55291.1 [O00712-5]
CCDS6474.1 [O00712-1]
CCDS65007.1 [O00712-6]
RefSeqiNP_001177666.1, NM_001190737.1 [O00712-5]
NP_001177667.1, NM_001190738.1
NP_001269716.1, NM_001282787.1 [O00712-6]
NP_005587.2, NM_005596.3 [O00712-1]
UniGeneiHs.644095

Genome annotation databases

EnsembliENST00000380953; ENSP00000370340; ENSG00000147862 [O00712-5]
ENST00000380959; ENSP00000370346; ENSG00000147862 [O00712-1]
ENST00000543693; ENSP00000442888; ENSG00000147862 [O00712-6]
GeneIDi4781
KEGGihsa:4781
UCSCiuc003zld.4 human [O00712-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U85193 mRNA Translation: AAB41899.1
U70862 mRNA Translation: AAB51197.1
BT007266 mRNA Translation: AAP35930.1
AK131233 mRNA Translation: BAD18416.1
BX648416 mRNA Translation: CAH56156.1
BX648845 mRNA No translation available.
AL136366 Genomic DNA No translation available.
AL441963 Genomic DNA No translation available.
AL137017 Genomic DNA No translation available.
AL449443 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58697.1
CH471071 Genomic DNA Translation: EAW58699.1
BC001283 mRNA Translation: AAH01283.1
U07810 mRNA Translation: AAA93125.1
CCDSiCCDS55291.1 [O00712-5]
CCDS6474.1 [O00712-1]
CCDS65007.1 [O00712-6]
RefSeqiNP_001177666.1, NM_001190737.1 [O00712-5]
NP_001177667.1, NM_001190738.1
NP_001269716.1, NM_001282787.1 [O00712-6]
NP_005587.2, NM_005596.3 [O00712-1]
UniGeneiHs.644095

3D structure databases

ProteinModelPortaliO00712
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110853, 15 interactors
DIPiDIP-61433N
IntActiO00712, 6 interactors
STRINGi9606.ENSP00000370340

PTM databases

iPTMnetiO00712
PhosphoSitePlusiO00712

Polymorphism and mutation databases

BioMutaiNFIB

Proteomic databases

EPDiO00712
PaxDbiO00712
PeptideAtlasiO00712
PRIDEiO00712
ProteomicsDBi48006
48007 [O00712-2]

Protocols and materials databases

DNASUi4781
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380953; ENSP00000370340; ENSG00000147862 [O00712-5]
ENST00000380959; ENSP00000370346; ENSG00000147862 [O00712-1]
ENST00000543693; ENSP00000442888; ENSG00000147862 [O00712-6]
GeneIDi4781
KEGGihsa:4781
UCSCiuc003zld.4 human [O00712-1]

Organism-specific databases

CTDi4781
DisGeNETi4781
EuPathDBiHostDB:ENSG00000147862.14
GeneCardsiNFIB
HGNCiHGNC:7785 NFIB
HPAiHPA003956
MIMi600728 gene
neXtProtiNX_O00712
OpenTargetsiENSG00000147862
PharmGKBiPA31591
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3663 Eukaryota
ENOG410Y16G LUCA
GeneTreeiENSGT00390000009905
HOGENOMiHOG000013028
HOVERGENiHBG006561
InParanoidiO00712
KOiK09169
PhylomeDBiO00712
TreeFamiTF313889

Enzyme and pathway databases

ReactomeiR-HSA-73980 RNA Polymerase III Transcription Termination
R-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation
SignaLinkiO00712
SIGNORiO00712

Miscellaneous databases

ChiTaRSiNFIB human
GeneWikiiNFIB_(gene)
GenomeRNAii4781
PROiPR:O00712
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000147862 Expressed in 249 organ(s), highest expression level in cerebral cortex
CleanExiHS_NFIB
ExpressionAtlasiO00712 baseline and differential
GenevisibleiO00712 HS

Family and domain databases

InterProiView protein in InterPro
IPR000647 CTF/NFI
IPR020604 CTF/NFI_DNA-bd-dom
IPR019739 CTF/NFI_DNA-bd_CS
IPR019548 CTF/NFI_DNA-bd_N
IPR003619 MAD_homology1_Dwarfin-type
PANTHERiPTHR11492 PTHR11492, 1 hit
PfamiView protein in Pfam
PF00859 CTF_NFI, 1 hit
PF03165 MH1, 1 hit
PF10524 NfI_DNAbd_pre-N, 1 hit
SMARTiView protein in SMART
SM00523 DWA, 1 hit
PROSITEiView protein in PROSITE
PS00349 CTF_NFI_1, 1 hit
PS51080 CTF_NFI_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNFIB_HUMAN
AccessioniPrimary (citable) accession number: O00712
Secondary accession number(s): G3V1P1
, H7BYE8, O00166, Q12858, Q5VW29, Q63HM5, Q6ZNF9, Q96J45
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: March 15, 2004
Last modified: November 7, 2018
This is version 167 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again