Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 141 (08 May 2019)
Sequence version 2 (19 Sep 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sodium-dependent phosphate transport protein 3

Gene

SLC17A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in actively transporting phosphate into cells via Na+ cotransport.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Sodium transport, Symport, Transport
LigandSodium

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.1.14.29 the major facilitator superfamily (mfs)

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium-dependent phosphate transport protein 3
Alternative name(s):
Na(+)/PI cotransporter 3
Sodium/phosphate cotransporter 3
Solute carrier family 17 member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC17A2
Synonyms:NPT3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10930 SLC17A2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611049 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O00624

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei98 – 118HelicalSequence analysisAdd BLAST21
Transmembranei130 – 150HelicalSequence analysisAdd BLAST21
Transmembranei183 – 203HelicalSequence analysisAdd BLAST21
Transmembranei211 – 231HelicalSequence analysisAdd BLAST21
Transmembranei273 – 293HelicalSequence analysisAdd BLAST21
Transmembranei317 – 337HelicalSequence analysisAdd BLAST21
Transmembranei350 – 369HelicalSequence analysisAdd BLAST20
Transmembranei374 – 396HelicalSequence analysisAdd BLAST23
Transmembranei415 – 435HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10246

Open Targets

More...
OpenTargetsi
ENSG00000112337

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35821

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3769300

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC17A2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002209401 – 439Sodium-dependent phosphate transport protein 3Add BLAST439

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi47N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi56N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi68N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi69N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O00624

PeptideAtlas

More...
PeptideAtlasi
O00624

PRoteomics IDEntifications database

More...
PRIDEi
O00624

ProteomicsDB human proteome resource

More...
ProteomicsDBi
47997
47998 [O00624-2]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O00624

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the small intestine, kidney, spleen and testis. Not detected in fetal brain, bone marrow, and mammary gland.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000112337 Expressed in 15 organ(s), highest expression level in liver

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O00624 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O00624 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038270

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115540, 56 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000367081

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2532 Eukaryota
ENOG410XPWC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161926

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230813

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O00624

KEGG Orthology (KO)

More...
KOi
K12300

Identification of Orthologs from Complete Genome Data

More...
OMAi
GMMINYF

Database of Orthologous Groups

More...
OrthoDBi
497052at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O00624

TreeFam database of animal gene trees

More...
TreeFami
TF313535

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06174 MFS, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07690 MFS_1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103473 SSF103473, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50850 MFS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O00624-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDGKPATRKG PDFCSLRYGL ALIMHFSNFT MITQRVSLSI AIIAMVNTTQ
60 70 80 90 100
QQGLSNASTE GPVADAFNNS SISIKEFDTK ASVYQWSPET QGIIFSSINY
110 120 130 140 150
GIILTLIPSG YLAGIFGAKK MLGAGLLISS LLTLFTPLAA DFGVILVIMV
160 170 180 190 200
RTVQGMAQGM AWTGQFTIWA KWAPPLERSK LTTIAGSGSA FGSFIILCVG
210 220 230 240 250
GLISQALSWP FIFYIFGSTG CVCCLLWFTV IYDDPMHHPC ISVREKEHIL
260 270 280 290 300
SSLAQQPSSP GRAVPIKAMV TCLPLWAIFL GFFSHFWLCT IILTYLPTYI
310 320 330 340 350
STLLHVNIRD SGVLSSLPFI AAASCTILGG QLADFLLSRN LLRLITVRKL
360 370 380 390 400
FSSLGLLLPS ICAVALPFVA SSYVITIILL ILIPGTSNLC DSGFIINTLD
410 420 430
IAPRYASFLM GISRGFGLIA GIISSTATGF LISQVGPVY
Length:439
Mass (Da):47,277
Last modified:September 19, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i67494C6E00EABB54
GO
Isoform 2 (identifier: O00624-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     355-439: GLLLPSICAV...FLISQVGPVY → DMQVSSWESQ...PASEDIKLQT

Show »
Length:436
Mass (Da):47,350
Checksum:iDF02F618E83A572F
GO
Isoform 3 (identifier: O00624-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     435-439: VGPVY → DFESGWRNVFFLSAAVNMFGLVFYLTFGQAELQDWAKERTLTRL

Note: No experimental confirmation available.
Show »
Length:478
Mass (Da):51,919
Checksum:i72E5FF8F3498D28D
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_020638355 – 439GLLLP…VGPVY → DMQVSSWESQGDLGSSQESS LPLPLDSSSVRILSLVGGMS FSCLLQSTCLAWSFTSRLDK QNFKTGPKRGPLPASEDIKL QT in isoform 2. 2 PublicationsAdd BLAST85
Alternative sequenceiVSP_054712435 – 439VGPVY → DFESGWRNVFFLSAAVNMFG LVFYLTFGQAELQDWAKERT LTRL in isoform 3. 1 Publication5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U91328 Genomic DNA Translation: AAB82085.1
U90544 mRNA Translation: AAB53422.1
AL138726 Genomic DNA No translation available.
CH471087 Genomic DNA Translation: EAW55498.1
CH471087 Genomic DNA Translation: EAW55499.1
BC104822 mRNA Translation: AAI04823.1
BC112033 mRNA Translation: AAI12034.1
BC143323 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4567.1 [O00624-2]
CCDS69060.1 [O00624-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001273052.1, NM_001286123.1 [O00624-3]
NP_001273054.1, NM_001286125.1
NP_005826.1, NM_005835.3 [O00624-2]
XP_005248841.1, XM_005248784.2 [O00624-3]
XP_006715012.1, XM_006714949.3 [O00624-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000265425; ENSP00000265425; ENSG00000112337 [O00624-1]
ENST00000360488; ENSP00000353677; ENSG00000112337 [O00624-2]
ENST00000377850; ENSP00000367081; ENSG00000112337 [O00624-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10246

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10246

UCSC genome browser

More...
UCSCi
uc003nfl.5 human [O00624-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U91328 Genomic DNA Translation: AAB82085.1
U90544 mRNA Translation: AAB53422.1
AL138726 Genomic DNA No translation available.
CH471087 Genomic DNA Translation: EAW55498.1
CH471087 Genomic DNA Translation: EAW55499.1
BC104822 mRNA Translation: AAI04823.1
BC112033 mRNA Translation: AAI12034.1
BC143323 mRNA No translation available.
CCDSiCCDS4567.1 [O00624-2]
CCDS69060.1 [O00624-3]
RefSeqiNP_001273052.1, NM_001286123.1 [O00624-3]
NP_001273054.1, NM_001286125.1
NP_005826.1, NM_005835.3 [O00624-2]
XP_005248841.1, XM_005248784.2 [O00624-3]
XP_006715012.1, XM_006714949.3 [O00624-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi115540, 56 interactors
STRINGi9606.ENSP00000367081

Chemistry databases

ChEMBLiCHEMBL3769300

Protein family/group databases

TCDBi2.A.1.14.29 the major facilitator superfamily (mfs)

PTM databases

PhosphoSitePlusiO00624

Polymorphism and mutation databases

BioMutaiSLC17A2

Proteomic databases

PaxDbiO00624
PeptideAtlasiO00624
PRIDEiO00624
ProteomicsDBi47997
47998 [O00624-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265425; ENSP00000265425; ENSG00000112337 [O00624-1]
ENST00000360488; ENSP00000353677; ENSG00000112337 [O00624-2]
ENST00000377850; ENSP00000367081; ENSG00000112337 [O00624-3]
GeneIDi10246
KEGGihsa:10246
UCSCiuc003nfl.5 human [O00624-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10246
DisGeNETi10246

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC17A2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0122218
HGNCiHGNC:10930 SLC17A2
HPAiHPA038270
MIMi611049 gene
neXtProtiNX_O00624
OpenTargetsiENSG00000112337
PharmGKBiPA35821

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2532 Eukaryota
ENOG410XPWC LUCA
GeneTreeiENSGT00940000161926
HOGENOMiHOG000230813
InParanoidiO00624
KOiK12300
OMAiGMMINYF
OrthoDBi497052at2759
PhylomeDBiO00624
TreeFamiTF313535

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10246

Protein Ontology

More...
PROi
PR:O00624

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000112337 Expressed in 15 organ(s), highest expression level in liver
ExpressionAtlasiO00624 baseline and differential
GenevisibleiO00624 HS

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
PfamiView protein in Pfam
PF07690 MFS_1, 1 hit
SUPFAMiSSF103473 SSF103473, 1 hit
PROSITEiView protein in PROSITE
PS50850 MFS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNPT3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00624
Secondary accession number(s): A6NK81
, A6NLD6, Q5TB84, Q76P85
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 19, 2006
Last modified: May 8, 2019
This is version 141 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again