Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 153 (13 Feb 2019)
Sequence version 1 (01 Jul 1997)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Receptor-binding cancer antigen expressed on SiSo cells

Gene

EBAG9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.3 Publications

Miscellaneous

May serve as a prognostic marker for cancers such as adenocarcinomas of the lung and breast cancers. It is present and overexpressed in many patients suffering from breast carcinomas, its level of expression correlates with tumor grade, suggesting that it may be involved in cancer immune escape. According to PubMed:12672804, it is however not directly a tumor-associated antigen, but it rather modulates surface expression of tumor-associated O-linked glycan Tn when it is overexpressed, suggesting that it contributes indirectly to the antigenicity of tumor cells.

Caution

It was initially reported to be a ligand for some putative receptor present on T-, B-, natural killer (NK) cells and various human cell lines. However, PubMed:12672804 showed that it does not bind any receptor.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • peptidase activator activity involved in apoptotic process Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-9018519 Estrogen-dependent gene expression

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Receptor-binding cancer antigen expressed on SiSo cells
Alternative name(s):
Cancer-associated surface antigen RCAS1
Estrogen receptor-binding fragment-associated gene 9 protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EBAG9
Synonyms:RCAS1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000147654.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3123 EBAG9

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605772 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O00559

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 6ExtracellularSequence analysis6
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei7 – 27Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
Topological domaini28 – 213CytoplasmicSequence analysisAdd BLAST186

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9166

Open Targets

More...
OpenTargetsi
ENSG00000147654

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27581

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
EBAG9

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000971951 – 213Receptor-binding cancer antigen expressed on SiSo cellsAdd BLAST213

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei36PhosphoserineCombined sources1
Modified residuei41PhosphothreonineCombined sources1
Modified residuei94PhosphotyrosineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O00559

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O00559

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O00559

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O00559

PeptideAtlas

More...
PeptideAtlasi
O00559

PRoteomics IDEntifications database

More...
PRIDEi
O00559

ProteomicsDB human proteome resource

More...
ProteomicsDBi
47973

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O00559

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O00559

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O00559

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed in ovary, testis, prostate, thymus, muscle and heart, but not in small intestine, colon, lymph nodes, or peripherical blood lymphocytes. The protein is not detected in any of the above organs.

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By estrogen.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000147654 Expressed in 239 organ(s), highest expression level in parotid gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O00559 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O00559 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB072810
CAB072811
CAB072812
HPA021153
HPA021154

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114607, 3 interactors

Protein interaction database and analysis system

More...
IntActi
O00559, 28 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000337675

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O00559

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili163 – 211Sequence analysisAdd BLAST49

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi160 – 163Poly-Glu4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The coiled coil domain is necessary for the homodimerization.

Keywords - Domaini

Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IE57 Eukaryota
ENOG41101KS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004040

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000073537

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG059707

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O00559

KEGG Orthology (KO)

More...
KOi
K22455

Identification of Orthologs from Complete Genome Data

More...
OMAi
FRLFKIC

Database of Orthologous Groups

More...
OrthoDBi
1552653at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O00559

TreeFam database of animal gene trees

More...
TreeFami
TF326584

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017025 Cancer-assoc_antigen_RCAS1

The PANTHER Classification System

More...
PANTHERi
PTHR15208 PTHR15208, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF034247 RCAS1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O00559-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAITQFRLFK FCTCLATVFS FLKRLICRSG RGRKLSGDQI TLPTTVDYSS
60 70 80 90 100
VPKQTDVEEW TSWDEDAPTS VKIEGGNGNV ATQQNSLEQL EPDYFKDMTP
110 120 130 140 150
TIRKTQKIVI KKREPLNFGI PDGSTGFSSR LAATQDLPFI HQSSELGDLD
160 170 180 190 200
TWQENTNAWE EEEDAAWQAE EVLRQQKLAD REKRAAEQQR KKMEKEAQRL
210
MKKEQNKIGV KLS
Length:213
Mass (Da):24,377
Last modified:July 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB115E741E23891C5
GO
Isoform 2 (identifier: O00559-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     174-174: R → RSRTNVCLLCSLLFHHPTPTSTPYINQSVKIERVSLGQWSYGKSKE

Show »
Length:258
Mass (Da):29,466
Checksum:i98ECCBCEA9BA1B9C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PND3E9PND3_HUMAN
Receptor-binding cancer antigen exp...
EBAG9
153Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PN10E9PN10_HUMAN
Receptor-binding cancer antigen-exp...
EBAG9
197Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJ38E9PJ38_HUMAN
Receptor-binding cancer antigen-exp...
EBAG9
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJ40E9PJ40_HUMAN
Receptor-binding cancer antigen-exp...
EBAG9
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti183K → E in AAH05249 (PubMed:15489334).Curated1
Sequence conflicti199R → Q in BAF83340 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_055503174R → RSRTNVCLLCSLLFHHPTPT STPYINQSVKIERVSLGQWS YGKSKE in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF006265 mRNA Translation: AAB61617.1
AB007619 mRNA Translation: BAA22572.1
AY653072 mRNA Translation: AAU85838.1
AK290651 mRNA Translation: BAF83340.1
CR456984 mRNA Translation: CAG33265.1
AC079061 Genomic DNA No translation available.
AP000427 Genomic DNA No translation available.
BC005249 mRNA Translation: AAH05249.1
BC017729 mRNA Translation: AAH17729.1
BC022506 mRNA Translation: AAH22506.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS6313.1 [O00559-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001265867.1, NM_001278938.1 [O00559-1]
NP_004206.1, NM_004215.4 [O00559-1]
NP_936056.1, NM_198120.2 [O00559-1]
XP_016869449.1, XM_017013960.1 [O00559-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.409368
Hs.632960

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000337573; ENSP00000337675; ENSG00000147654 [O00559-1]
ENST00000395785; ENSP00000379131; ENSG00000147654 [O00559-1]
ENST00000531677; ENSP00000432082; ENSG00000147654 [O00559-2]
ENST00000614147; ENSP00000477734; ENSG00000147654 [O00559-2]
ENST00000620557; ENSP00000477645; ENSG00000147654 [O00559-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9166

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9166

UCSC genome browser

More...
UCSCi
uc003ynf.5 human [O00559-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF006265 mRNA Translation: AAB61617.1
AB007619 mRNA Translation: BAA22572.1
AY653072 mRNA Translation: AAU85838.1
AK290651 mRNA Translation: BAF83340.1
CR456984 mRNA Translation: CAG33265.1
AC079061 Genomic DNA No translation available.
AP000427 Genomic DNA No translation available.
BC005249 mRNA Translation: AAH05249.1
BC017729 mRNA Translation: AAH17729.1
BC022506 mRNA Translation: AAH22506.1
CCDSiCCDS6313.1 [O00559-1]
RefSeqiNP_001265867.1, NM_001278938.1 [O00559-1]
NP_004206.1, NM_004215.4 [O00559-1]
NP_936056.1, NM_198120.2 [O00559-1]
XP_016869449.1, XM_017013960.1 [O00559-1]
UniGeneiHs.409368
Hs.632960

3D structure databases

ProteinModelPortaliO00559
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114607, 3 interactors
IntActiO00559, 28 interactors
STRINGi9606.ENSP00000337675

PTM databases

iPTMnetiO00559
PhosphoSitePlusiO00559
SwissPalmiO00559

Polymorphism and mutation databases

BioMutaiEBAG9

Proteomic databases

EPDiO00559
jPOSTiO00559
MaxQBiO00559
PaxDbiO00559
PeptideAtlasiO00559
PRIDEiO00559
ProteomicsDBi47973

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9166
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000337573; ENSP00000337675; ENSG00000147654 [O00559-1]
ENST00000395785; ENSP00000379131; ENSG00000147654 [O00559-1]
ENST00000531677; ENSP00000432082; ENSG00000147654 [O00559-2]
ENST00000614147; ENSP00000477734; ENSG00000147654 [O00559-2]
ENST00000620557; ENSP00000477645; ENSG00000147654 [O00559-1]
GeneIDi9166
KEGGihsa:9166
UCSCiuc003ynf.5 human [O00559-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9166
DisGeNETi9166
EuPathDBiHostDB:ENSG00000147654.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
EBAG9
HGNCiHGNC:3123 EBAG9
HPAiCAB072810
CAB072811
CAB072812
HPA021153
HPA021154
MIMi605772 gene
neXtProtiNX_O00559
OpenTargetsiENSG00000147654
PharmGKBiPA27581

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IE57 Eukaryota
ENOG41101KS LUCA
GeneTreeiENSGT00390000004040
HOGENOMiHOG000073537
HOVERGENiHBG059707
InParanoidiO00559
KOiK22455
OMAiFRLFKIC
OrthoDBi1552653at2759
PhylomeDBiO00559
TreeFamiTF326584

Enzyme and pathway databases

ReactomeiR-HSA-9018519 Estrogen-dependent gene expression

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
EBAG9 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
EBAG9

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9166

Protein Ontology

More...
PROi
PR:O00559

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000147654 Expressed in 239 organ(s), highest expression level in parotid gland
ExpressionAtlasiO00559 baseline and differential
GenevisibleiO00559 HS

Family and domain databases

InterProiView protein in InterPro
IPR017025 Cancer-assoc_antigen_RCAS1
PANTHERiPTHR15208 PTHR15208, 1 hit
PIRSFiPIRSF034247 RCAS1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRCAS1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00559
Secondary accession number(s): A8K3N6
, Q5Y8C7, Q6IB20, Q9BS76
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 1, 1997
Last modified: February 13, 2019
This is version 153 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again