Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leukocyte-specific transcript 1 protein

Gene

LST1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell shape, Immunity

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Leukocyte-specific transcript 1 protein
Alternative name(s):
Protein B144
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LST1
Synonyms:B144
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000204482.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14189 LST1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
109170 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O00453

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei8 – 28HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7940

Open Targets

More...
OpenTargetsi
ENSG00000204482

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37856

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LST1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000845071 – 97Leukocyte-specific transcript 1 proteinAdd BLAST97

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei58PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O00453

PeptideAtlas

More...
PeptideAtlasi
O00453

PRoteomics IDEntifications database

More...
PRIDEi
O00453

ProteomicsDB human proteome resource

More...
ProteomicsDBi
47899
47900 [O00453-10]
47901 [O00453-2]
47902 [O00453-3]
47903 [O00453-4]
47904 [O00453-5]
47905 [O00453-6]
47906 [O00453-7]
47907 [O00453-8]
47908 [O00453-9]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
O00453-12 [O00453-12]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O00453

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O00453

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O00453

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By IFNG/IFN-gamma. Up-regulated upon autoimmune and bacterially-induced inflammation.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204482 Expressed in 194 organ(s), highest expression level in leukocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_LST1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O00453 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O00453 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
O00453, 2 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O00453

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the LST1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000112003

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000039999

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG045577

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O00453

Identification of Orthologs from Complete Genome Data

More...
OMAi
ACIAKNK

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O00453

TreeFam database of animal gene trees

More...
TreeFami
TF338533

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007775 Leukocyte-sp_tscrpt_1_LST1

The PANTHER Classification System

More...
PANTHERi
PTHR15452 PTHR15452, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05083 LST1, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF037638 Leukocyte-sp_tscrpt_1_LST1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (13+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 13 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.1 Publication

This entry has 13 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: O00453-1) [UniParc]FASTAAdd to basket
Also known as: LST1/A1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLSRNDDICI YGGLGLGGLL LLAVVLLSAC LCWLHRRVKR LERSWAQGSS
60 70 80 90
EQELHYASLQ RLPVPSSEGP DLRGRDKRGT KEDPRADYAC IAENKPT
Length:97
Mass (Da):10,792
Last modified:September 23, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAA03C77B5787B524
GO
Isoform 21 Publication (identifier: O00453-2) [UniParc]FASTAAdd to basket
Also known as: LST1/C1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MLSRNDDICI...RRVKRLERSW → MIYVSTGAWG...IEEHLLSWSQ

Show »
Length:91
Mass (Da):10,133
Checksum:i84A4FCD274A92DEA
GO
Isoform 31 Publication (identifier: O00453-3) [UniParc]FASTAAdd to basket
Also known as: pLst11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MLSRNDDICI...RRVKRLERSW → MIYVSTGAWGWAGSCFWQWSFCPPACVGCIEEE

Show »
Length:85
Mass (Da):9,410
Checksum:i0276676D528C49A6
GO
Isoform 41 Publication (identifier: O00453-4) [UniParc]FASTAAdd to basket
Also known as: LST1/E1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWA → MT

Show »
Length:53
Mass (Da):5,887
Checksum:i5A924968D231E74F
GO
Isoform 51 Publication (identifier: O00453-5) [UniParc]FASTAAdd to basket
Also known as: LST1/K1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     38-97: VKRLERSWAQ...YACIAENKPT → GPGLLRAGTPLCISAEAASAQQ

Show »
Length:59
Mass (Da):6,122
Checksum:iFC2FF156D576C486
GO
Isoform 61 Publication (identifier: O00453-6) [UniParc]FASTAAdd to basket
Also known as: LST1/L1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     7-37: Missing.
     46-60: Missing.

Show »
Length:51
Mass (Da):5,869
Checksum:iB5A041EAFE936EDC
GO
Isoform 71 Publication (identifier: O00453-7) [UniParc]FASTAAdd to basket
Also known as: LST1/J1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     7-37: Missing.
     46-97: AQGSSEQELH...YACIAENKPT → HLSVLVPGPGLLRAGTPLCISAEAASAQQ

Show »
Length:43
Mass (Da):4,629
Checksum:iE19730B87CE1D4B6
GO
Isoform 81 Publication (identifier: O00453-8) [UniParc]FASTAAdd to basket
Also known as: LST1/M1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     7-97: DICIYGGLGL...YACIAENKPT → APSVLVPGPGLLRAGTPLCISAEAASAQQ

Show »
Length:35
Mass (Da):3,492
Checksum:iB2C9F24119316035
GO
Isoform 91 Publication (identifier: O00453-9) [UniParc]FASTAAdd to basket
Also known as: LST1/N1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     7-13: DICIYGG → EAASAQQ
     14-97: Missing.

Show »
Length:13
Mass (Da):1,421
Checksum:i9E7701449EE4DB1A
GO
Isoform 10 (identifier: O00453-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-37: Missing.

Show »
Length:66
Mass (Da):7,498
Checksum:iF6ECD034EE4D29B1
GO
Isoform 11 (identifier: O00453-11) [UniParc]FASTAAdd to basket
Also known as: LST1/P

The sequence of this isoform differs from the canonical sequence as follows:
     45-45: W → WHLLSWSQ

Show »
Length:104
Mass (Da):11,644
Checksum:i78F66572BADB20E3
GO
Isoform 12 (identifier: O00453-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     38-97: VKRLERSWAQ...YACIAENKPT → APSVLVPGPGLLRAGTPLCISAEAASAQQ

Note: No experimental confirmation available.
Show »
Length:66
Mass (Da):6,786
Checksum:iEAFB5CA007926ED4
GO
Isoform 13 (identifier: O00453-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-37: Missing.
     45-45: W → WHLLSWSQ

Note: No experimental confirmation available.
Show »
Length:73
Mass (Da):8,350
Checksum:iF379101B30F3A4CF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C4M3H7C4M3_HUMAN
Leukocyte-specific transcript 1 pro...
LST1
35Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2M1F2Z2M1_HUMAN
Leukocyte-specific transcript 1 pro...
LST1
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q2HNT4Q2HNT4_HUMAN
LST1/O
LST1
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5HYT5Q5HYT5_HUMAN
Leukocyte-specific transcript 1 pro...
LST1
36Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4Z3H7C4Z3_HUMAN
Leukocyte-specific transcript 1 pro...
LST1
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A024RCL9A0A024RCL9_HUMAN
Leukocyte specific transcript 1, is...
LST1 hCG_43689
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JIN5A0A0G2JIN5_HUMAN
Leukocyte-specific transcript 1 pro...
LST1
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JHS1A0A0G2JHS1_HUMAN
Leukocyte-specific transcript 1 pro...
LST1
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5STB1Q5STB1_HUMAN
Leukocyte-specific transcript 1 pro...
LST1
28Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JIG4A0A0G2JIG4_HUMAN
Leukocyte-specific transcript 1 pro...
LST1
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAX45332 differs from that shown. Reason: Erroneous termination at position 47. Translated as Gln.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti21L → P in AAX45332 (PubMed:16362817).Curated1
Sequence conflicti46A → T in AAB86999 (PubMed:9367684).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0505771 – 46MLSRN…ERSWA → MT in isoform 4. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_0505781 – 45MLSRN…LERSW → MIYVSTGAWGWAGSCFWQWS FCPPACVGCIEEHLLSWSQ in isoform 2. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0505791 – 45MLSRN…LERSW → MIYVSTGAWGWAGSCFWQWS FCPPACVGCIEEE in isoform 3. CuratedAdd BLAST45
Alternative sequenceiVSP_0505807 – 97DICIY…ENKPT → APSVLVPGPGLLRAGTPLCI SAEAASAQQ in isoform 8. 1 PublicationAdd BLAST91
Alternative sequenceiVSP_0505837 – 37Missing in isoform 6, isoform 7, isoform 10 and isoform 13. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_0505817 – 13DICIYGG → EAASAQQ in isoform 9. 1 Publication7
Alternative sequenceiVSP_05058214 – 97Missing in isoform 9. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_04736738 – 97VKRLE…ENKPT → APSVLVPGPGLLRAGTPLCI SAEAASAQQ in isoform 12. CuratedAdd BLAST60
Alternative sequenceiVSP_05058438 – 97VKRLE…ENKPT → GPGLLRAGTPLCISAEAASA QQ in isoform 5. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_04645945W → WHLLSWSQ in isoform 11 and isoform 13. 1 Publication1
Alternative sequenceiVSP_05058646 – 97AQGSS…ENKPT → HLSVLVPGPGLLRAGTPLCI SAEAASAQQ in isoform 7. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_05058746 – 60Missing in isoform 6. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U00921 Genomic DNA Translation: AAB57724.1
AF000424 mRNA Translation: AAB86998.1
AF000425 mRNA Translation: AAB86999.1
AF000426 mRNA Translation: AAB87000.1
Y18486 mRNA Translation: CAB59904.1
Y18487 mRNA Translation: CAB59905.1
Y18488 mRNA Translation: CAB60038.1
Y18489 mRNA Translation: CAB59906.1
Y18490 mRNA Translation: CAB59903.1
AF129756 Genomic DNA Translation: AAD18090.1
BA000025 Genomic DNA Translation: BAB63394.1
AL662801 Genomic DNA No translation available.
AL662847 Genomic DNA No translation available.
AL929587 Genomic DNA No translation available.
BX248519 Genomic DNA No translation available.
BX927320 Genomic DNA No translation available.
CR753892 Genomic DNA No translation available.
CR759886 Genomic DNA No translation available.
CR942185 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03427.1
CH471081 Genomic DNA Translation: EAX03431.1
BC103855 mRNA Translation: AAI03856.1
BC103856 mRNA Translation: AAI03857.1
AY852266 mRNA Translation: AAX45332.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43450.2 [O00453-1]
CCDS4705.2 [O00453-10]
CCDS54984.1 [O00453-11]
CCDS54985.1 [O00453-12]
CCDS54986.1 [O00453-5]
CCDS54987.1 [O00453-13]

NCBI Reference Sequences

More...
RefSeqi
NP_001160010.1, NM_001166538.1 [O00453-13]
NP_009092.3, NM_007161.3 [O00453-11]
NP_995309.2, NM_205837.2 [O00453-12]
NP_995310.2, NM_205838.2 [O00453-10]
NP_995311.2, NM_205839.2 [O00453-1]
NP_995312.2, NM_205840.2 [O00453-5]
XP_006715269.1, XM_006715206.3 [O00453-11]
XP_006715272.1, XM_006715209.3 [O00453-13]
XP_006715273.1, XM_006715210.3 [O00453-5]
XP_011513216.1, XM_011514914.2 [O00453-11]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.436066

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000303757; ENSP00000303649; ENSG00000204482 [O00453-5]
ENST00000339530; ENSP00000339201; ENSG00000204482 [O00453-12]
ENST00000376086; ENSP00000365254; ENSG00000204482 [O00453-13]
ENST00000376089; ENSP00000365257; ENSG00000204482 [O00453-10]
ENST00000376092; ENSP00000365260; ENSG00000204482 [O00453-8]
ENST00000376093; ENSP00000365261; ENSG00000204482 [O00453-11]
ENST00000376096; ENSP00000365264; ENSG00000204482 [O00453-9]
ENST00000376110; ENSP00000365278; ENSG00000204482 [O00453-6]
ENST00000383480; ENSP00000372972; ENSG00000206433 [O00453-13]
ENST00000383482; ENSP00000372974; ENSG00000206433 [O00453-8]
ENST00000383484; ENSP00000372976; ENSG00000206433 [O00453-12]
ENST00000383486; ENSP00000372978; ENSG00000206433 [O00453-11]
ENST00000400250; ENSP00000383109; ENSG00000206433 [O00453-5]
ENST00000400257; ENSP00000383116; ENSG00000206433 [O00453-9]
ENST00000400262; ENSP00000383121; ENSG00000206433 [O00453-10]
ENST00000400263; ENSP00000383122; ENSG00000206433 [O00453-10]
ENST00000400264; ENSP00000383123; ENSG00000206433 [O00453-1]
ENST00000400265; ENSP00000383124; ENSG00000206433 [O00453-6]
ENST00000411490; ENSP00000395409; ENSG00000235915 [O00453-1]
ENST00000412041; ENSP00000399411; ENSG00000231048 [O00453-11]
ENST00000412623; ENSP00000409229; ENSG00000226182 [O00453-11]
ENST00000413426; ENSP00000408876; ENSG00000231048 [O00453-9]
ENST00000414266; ENSP00000402707; ENSG00000223465 [O00453-10]
ENST00000415419; ENSP00000415143; ENSG00000235915 [O00453-6]
ENST00000415490; ENSP00000390658; ENSG00000234514 [O00453-8]
ENST00000415781; ENSP00000401655; ENSG00000226182 [O00453-9]
ENST00000417428; ENSP00000394614; ENSG00000223465 [O00453-1]
ENST00000418507; ENSP00000405900; ENSG00000204482 [O00453-10]
ENST00000420157; ENSP00000398700; ENSG00000226182 [O00453-10]
ENST00000420333; ENSP00000411547; ENSG00000230791 [O00453-5]
ENST00000420676; ENSP00000414246; ENSG00000226182 [O00453-13]
ENST00000420785; ENSP00000393345; ENSG00000234514 [O00453-12]
ENST00000420797; ENSP00000390587; ENSG00000235915 [O00453-10]
ENST00000422035; ENSP00000396431; ENSG00000226182 [O00453-6]
ENST00000422533; ENSP00000412627; ENSG00000226182 [O00453-5]
ENST00000423107; ENSP00000406438; ENSG00000234514 [O00453-10]
ENST00000423871; ENSP00000400069; ENSG00000223465 [O00453-6]
ENST00000425760; ENSP00000409698; ENSG00000231048 [O00453-8]
ENST00000426938; ENSP00000404051; ENSG00000234514 [O00453-1]
ENST00000427186; ENSP00000399439; ENSG00000235915 [O00453-8]
ENST00000427507; ENSP00000416283; ENSG00000223465 [O00453-1]
ENST00000428227; ENSP00000413526; ENSG00000234514 [O00453-10]
ENST00000428405; ENSP00000391963; ENSG00000230791 [O00453-10]
ENST00000428898; ENSP00000389694; ENSG00000230791 [O00453-9]
ENST00000429874; ENSP00000387560; ENSG00000230791 [O00453-1]
ENST00000429910; ENSP00000399063; ENSG00000223465 [O00453-5]
ENST00000430632; ENSP00000392949; ENSG00000231048 [O00453-1]
ENST00000430680; ENSP00000398918; ENSG00000235915 [O00453-12]
ENST00000430997; ENSP00000389795; ENSG00000235915 [O00453-5]
ENST00000432009; ENSP00000409433; ENSG00000226182 [O00453-10]
ENST00000432164; ENSP00000394834; ENSG00000223465 [O00453-8]
ENST00000433004; ENSP00000390430; ENSG00000226182 [O00453-10]
ENST00000433305; ENSP00000407417; ENSG00000230791 [O00453-8]
ENST00000433676; ENSP00000411866; ENSG00000235915 [O00453-10]
ENST00000434314; ENSP00000414173; ENSG00000226182 [O00453-1]
ENST00000436037; ENSP00000398685; ENSG00000234514 [O00453-11]
ENST00000436185; ENSP00000396579; ENSG00000235915 [O00453-10]
ENST00000437137; ENSP00000412276; ENSG00000231048 [O00453-1]
ENST00000437436; ENSP00000394891; ENSG00000231048 [O00453-6]
ENST00000437812; ENSP00000396179; ENSG00000223465 [O00453-11]
ENST00000438075; ENSP00000391929; ENSG00000204482 [O00453-1]
ENST00000438335; ENSP00000403097; ENSG00000235915 [O00453-11]
ENST00000438349; ENSP00000391057; ENSG00000234514 [O00453-6]
ENST00000438381; ENSP00000393282; ENSG00000230791 [O00453-12]
ENST00000440242; ENSP00000394815; ENSG00000223465 [O00453-13]
ENST00000440253; ENSP00000396235; ENSG00000223465 [O00453-10]
ENST00000440323; ENSP00000414744; ENSG00000231048 [O00453-10]
ENST00000440328; ENSP00000401516; ENSG00000226182 [O00453-8]
ENST00000442052; ENSP00000399474; ENSG00000226182 [O00453-12]
ENST00000443340; ENSP00000396533; ENSG00000206433 [O00453-1]
ENST00000443655; ENSP00000411961; ENSG00000231048 [O00453-5]
ENST00000443741; ENSP00000388956; ENSG00000235915 [O00453-1]
ENST00000446239; ENSP00000402873; ENSG00000230791 [O00453-6]
ENST00000447141; ENSP00000397826; ENSG00000235915 [O00453-9]
ENST00000447391; ENSP00000411087; ENSG00000230791 [O00453-10]
ENST00000448236; ENSP00000406455; ENSG00000230791 [O00453-11]
ENST00000448441; ENSP00000409008; ENSG00000206433 [O00453-10]
ENST00000449236; ENSP00000391420; ENSG00000231048 [O00453-10]
ENST00000449273; ENSP00000415623; ENSG00000234514 [O00453-5]
ENST00000450291; ENSP00000404500; ENSG00000230791 [O00453-13]
ENST00000450425; ENSP00000415168; ENSG00000223465 [O00453-10]
ENST00000451641; ENSP00000406625; ENSG00000223465 [O00453-12]
ENST00000451922; ENSP00000401567; ENSG00000231048 [O00453-13]
ENST00000452169; ENSP00000416808; ENSG00000231048 [O00453-12]
ENST00000453995; ENSP00000409163; ENSG00000230791 [O00453-1]
ENST00000454168; ENSP00000396004; ENSG00000234514 [O00453-13]
ENST00000455003; ENSP00000396181; ENSG00000226182 [O00453-1]
ENST00000455052; ENSP00000398228; ENSG00000234514 [O00453-10]
ENST00000455426; ENSP00000398780; ENSG00000231048 [O00453-10]
ENST00000455493; ENSP00000401650; ENSG00000223465 [O00453-9]
ENST00000455655; ENSP00000415526; ENSG00000230791 [O00453-10]
ENST00000455901; ENSP00000396378; ENSG00000234514 [O00453-1]
ENST00000457549; ENSP00000390885; ENSG00000235915 [O00453-13]
ENST00000458456; ENSP00000405920; ENSG00000234514 [O00453-9]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7940

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7940

UCSC genome browser

More...
UCSCi
uc021yus.1 human [O00453-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U00921 Genomic DNA Translation: AAB57724.1
AF000424 mRNA Translation: AAB86998.1
AF000425 mRNA Translation: AAB86999.1
AF000426 mRNA Translation: AAB87000.1
Y18486 mRNA Translation: CAB59904.1
Y18487 mRNA Translation: CAB59905.1
Y18488 mRNA Translation: CAB60038.1
Y18489 mRNA Translation: CAB59906.1
Y18490 mRNA Translation: CAB59903.1
AF129756 Genomic DNA Translation: AAD18090.1
BA000025 Genomic DNA Translation: BAB63394.1
AL662801 Genomic DNA No translation available.
AL662847 Genomic DNA No translation available.
AL929587 Genomic DNA No translation available.
BX248519 Genomic DNA No translation available.
BX927320 Genomic DNA No translation available.
CR753892 Genomic DNA No translation available.
CR759886 Genomic DNA No translation available.
CR942185 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03427.1
CH471081 Genomic DNA Translation: EAX03431.1
BC103855 mRNA Translation: AAI03856.1
BC103856 mRNA Translation: AAI03857.1
AY852266 mRNA Translation: AAX45332.1 Sequence problems.
CCDSiCCDS43450.2 [O00453-1]
CCDS4705.2 [O00453-10]
CCDS54984.1 [O00453-11]
CCDS54985.1 [O00453-12]
CCDS54986.1 [O00453-5]
CCDS54987.1 [O00453-13]
RefSeqiNP_001160010.1, NM_001166538.1 [O00453-13]
NP_009092.3, NM_007161.3 [O00453-11]
NP_995309.2, NM_205837.2 [O00453-12]
NP_995310.2, NM_205838.2 [O00453-10]
NP_995311.2, NM_205839.2 [O00453-1]
NP_995312.2, NM_205840.2 [O00453-5]
XP_006715269.1, XM_006715206.3 [O00453-11]
XP_006715272.1, XM_006715209.3 [O00453-13]
XP_006715273.1, XM_006715210.3 [O00453-5]
XP_011513216.1, XM_011514914.2 [O00453-11]
UniGeneiHs.436066

3D structure databases

ProteinModelPortaliO00453
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiO00453, 2 interactors

PTM databases

iPTMnetiO00453
PhosphoSitePlusiO00453
SwissPalmiO00453

Polymorphism and mutation databases

BioMutaiLST1

Proteomic databases

EPDiO00453
PeptideAtlasiO00453
PRIDEiO00453
ProteomicsDBi47899
47900 [O00453-10]
47901 [O00453-2]
47902 [O00453-3]
47903 [O00453-4]
47904 [O00453-5]
47905 [O00453-6]
47906 [O00453-7]
47907 [O00453-8]
47908 [O00453-9]
TopDownProteomicsiO00453-12 [O00453-12]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000303757; ENSP00000303649; ENSG00000204482 [O00453-5]
ENST00000339530; ENSP00000339201; ENSG00000204482 [O00453-12]
ENST00000376086; ENSP00000365254; ENSG00000204482 [O00453-13]
ENST00000376089; ENSP00000365257; ENSG00000204482 [O00453-10]
ENST00000376092; ENSP00000365260; ENSG00000204482 [O00453-8]
ENST00000376093; ENSP00000365261; ENSG00000204482 [O00453-11]
ENST00000376096; ENSP00000365264; ENSG00000204482 [O00453-9]
ENST00000376110; ENSP00000365278; ENSG00000204482 [O00453-6]
ENST00000383480; ENSP00000372972; ENSG00000206433 [O00453-13]
ENST00000383482; ENSP00000372974; ENSG00000206433 [O00453-8]
ENST00000383484; ENSP00000372976; ENSG00000206433 [O00453-12]
ENST00000383486; ENSP00000372978; ENSG00000206433 [O00453-11]
ENST00000400250; ENSP00000383109; ENSG00000206433 [O00453-5]
ENST00000400257; ENSP00000383116; ENSG00000206433 [O00453-9]
ENST00000400262; ENSP00000383121; ENSG00000206433 [O00453-10]
ENST00000400263; ENSP00000383122; ENSG00000206433 [O00453-10]
ENST00000400264; ENSP00000383123; ENSG00000206433 [O00453-1]
ENST00000400265; ENSP00000383124; ENSG00000206433 [O00453-6]
ENST00000411490; ENSP00000395409; ENSG00000235915 [O00453-1]
ENST00000412041; ENSP00000399411; ENSG00000231048 [O00453-11]
ENST00000412623; ENSP00000409229; ENSG00000226182 [O00453-11]
ENST00000413426; ENSP00000408876; ENSG00000231048 [O00453-9]
ENST00000414266; ENSP00000402707; ENSG00000223465 [O00453-10]
ENST00000415419; ENSP00000415143; ENSG00000235915 [O00453-6]
ENST00000415490; ENSP00000390658; ENSG00000234514 [O00453-8]
ENST00000415781; ENSP00000401655; ENSG00000226182 [O00453-9]
ENST00000417428; ENSP00000394614; ENSG00000223465 [O00453-1]
ENST00000418507; ENSP00000405900; ENSG00000204482 [O00453-10]
ENST00000420157; ENSP00000398700; ENSG00000226182 [O00453-10]
ENST00000420333; ENSP00000411547; ENSG00000230791 [O00453-5]
ENST00000420676; ENSP00000414246; ENSG00000226182 [O00453-13]
ENST00000420785; ENSP00000393345; ENSG00000234514 [O00453-12]
ENST00000420797; ENSP00000390587; ENSG00000235915 [O00453-10]
ENST00000422035; ENSP00000396431; ENSG00000226182 [O00453-6]
ENST00000422533; ENSP00000412627; ENSG00000226182 [O00453-5]
ENST00000423107; ENSP00000406438; ENSG00000234514 [O00453-10]
ENST00000423871; ENSP00000400069; ENSG00000223465 [O00453-6]
ENST00000425760; ENSP00000409698; ENSG00000231048 [O00453-8]
ENST00000426938; ENSP00000404051; ENSG00000234514 [O00453-1]
ENST00000427186; ENSP00000399439; ENSG00000235915 [O00453-8]
ENST00000427507; ENSP00000416283; ENSG00000223465 [O00453-1]
ENST00000428227; ENSP00000413526; ENSG00000234514 [O00453-10]
ENST00000428405; ENSP00000391963; ENSG00000230791 [O00453-10]
ENST00000428898; ENSP00000389694; ENSG00000230791 [O00453-9]
ENST00000429874; ENSP00000387560; ENSG00000230791 [O00453-1]
ENST00000429910; ENSP00000399063; ENSG00000223465 [O00453-5]
ENST00000430632; ENSP00000392949; ENSG00000231048 [O00453-1]
ENST00000430680; ENSP00000398918; ENSG00000235915 [O00453-12]
ENST00000430997; ENSP00000389795; ENSG00000235915 [O00453-5]
ENST00000432009; ENSP00000409433; ENSG00000226182 [O00453-10]
ENST00000432164; ENSP00000394834; ENSG00000223465 [O00453-8]
ENST00000433004; ENSP00000390430; ENSG00000226182 [O00453-10]
ENST00000433305; ENSP00000407417; ENSG00000230791 [O00453-8]
ENST00000433676; ENSP00000411866; ENSG00000235915 [O00453-10]
ENST00000434314; ENSP00000414173; ENSG00000226182 [O00453-1]
ENST00000436037; ENSP00000398685; ENSG00000234514 [O00453-11]
ENST00000436185; ENSP00000396579; ENSG00000235915 [O00453-10]
ENST00000437137; ENSP00000412276; ENSG00000231048 [O00453-1]
ENST00000437436; ENSP00000394891; ENSG00000231048 [O00453-6]
ENST00000437812; ENSP00000396179; ENSG00000223465 [O00453-11]
ENST00000438075; ENSP00000391929; ENSG00000204482 [O00453-1]
ENST00000438335; ENSP00000403097; ENSG00000235915 [O00453-11]
ENST00000438349; ENSP00000391057; ENSG00000234514 [O00453-6]
ENST00000438381; ENSP00000393282; ENSG00000230791 [O00453-12]
ENST00000440242; ENSP00000394815; ENSG00000223465 [O00453-13]
ENST00000440253; ENSP00000396235; ENSG00000223465 [O00453-10]
ENST00000440323; ENSP00000414744; ENSG00000231048 [O00453-10]
ENST00000440328; ENSP00000401516; ENSG00000226182 [O00453-8]
ENST00000442052; ENSP00000399474; ENSG00000226182 [O00453-12]
ENST00000443340; ENSP00000396533; ENSG00000206433 [O00453-1]
ENST00000443655; ENSP00000411961; ENSG00000231048 [O00453-5]
ENST00000443741; ENSP00000388956; ENSG00000235915 [O00453-1]
ENST00000446239; ENSP00000402873; ENSG00000230791 [O00453-6]
ENST00000447141; ENSP00000397826; ENSG00000235915 [O00453-9]
ENST00000447391; ENSP00000411087; ENSG00000230791 [O00453-10]
ENST00000448236; ENSP00000406455; ENSG00000230791 [O00453-11]
ENST00000448441; ENSP00000409008; ENSG00000206433 [O00453-10]
ENST00000449236; ENSP00000391420; ENSG00000231048 [O00453-10]
ENST00000449273; ENSP00000415623; ENSG00000234514 [O00453-5]
ENST00000450291; ENSP00000404500; ENSG00000230791 [O00453-13]
ENST00000450425; ENSP00000415168; ENSG00000223465 [O00453-10]
ENST00000451641; ENSP00000406625; ENSG00000223465 [O00453-12]
ENST00000451922; ENSP00000401567; ENSG00000231048 [O00453-13]
ENST00000452169; ENSP00000416808; ENSG00000231048 [O00453-12]
ENST00000453995; ENSP00000409163; ENSG00000230791 [O00453-1]
ENST00000454168; ENSP00000396004; ENSG00000234514 [O00453-13]
ENST00000455003; ENSP00000396181; ENSG00000226182 [O00453-1]
ENST00000455052; ENSP00000398228; ENSG00000234514 [O00453-10]
ENST00000455426; ENSP00000398780; ENSG00000231048 [O00453-10]
ENST00000455493; ENSP00000401650; ENSG00000223465 [O00453-9]
ENST00000455655; ENSP00000415526; ENSG00000230791 [O00453-10]
ENST00000455901; ENSP00000396378; ENSG00000234514 [O00453-1]
ENST00000457549; ENSP00000390885; ENSG00000235915 [O00453-13]
ENST00000458456; ENSP00000405920; ENSG00000234514 [O00453-9]
GeneIDi7940
KEGGihsa:7940
UCSCiuc021yus.1 human [O00453-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7940
DisGeNETi7940
EuPathDBiHostDB:ENSG00000204482.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LST1
HGNCiHGNC:14189 LST1
MIMi109170 gene
neXtProtiNX_O00453
OpenTargetsiENSG00000204482
PharmGKBiPA37856

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00730000112003
HOGENOMiHOG000039999
HOVERGENiHBG045577
InParanoidiO00453
OMAiACIAKNK
PhylomeDBiO00453
TreeFamiTF338533

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LST1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LST1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7940

Protein Ontology

More...
PROi
PR:O00453

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000204482 Expressed in 194 organ(s), highest expression level in leukocyte
CleanExiHS_LST1
ExpressionAtlasiO00453 baseline and differential
GenevisibleiO00453 HS

Family and domain databases

InterProiView protein in InterPro
IPR007775 Leukocyte-sp_tscrpt_1_LST1
PANTHERiPTHR15452 PTHR15452, 1 hit
PfamiView protein in Pfam
PF05083 LST1, 1 hit
PIRSFiPIRSF037638 Leukocyte-sp_tscrpt_1_LST1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLST1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00453
Secondary accession number(s): B0S8E0
, B0S8E1, B0S8E5, O00452, O00454, Q13669, Q2HNT3, Q5HYS9, Q5SP24, Q5STA5, Q5STA6, Q5STA7, Q5STA8, Q5STW6, Q9UJR5, Q9UJR6, Q9UJR7, Q9UJR8, Q9UJS1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 22, 2003
Last sequence update: September 23, 2008
Last modified: September 12, 2018
This is version 148 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again