Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

cGMP-dependent 3',5'-cyclic phosphodiesterase

Gene

PDE2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Plays an important role in growth and invasion of malignant melanoma cells (e.g. pseudomyxoma peritonei (PMP) cell line) (PubMed:24705027).1 Publication
Isoform PDE2A2: Regulates mitochondrial cAMP levels and respiration (By similarity). Involved in the regulation of mitochondria morphology/dynamics and apoptotic cell death via local modulation of cAMP/PKA signaling in the mitochondrion, including the monitoring of local cAMP levels at the outer mitochondrial membrane and of PKA-dependent phosphorylation of DNM1L (PubMed:28463107).By similarity1 Publication

Miscellaneous

cGMP binds at an allosteric activator site.By similarity

Catalytic activityi

Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.

Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei431cGMPBy similarity1
Binding sitei446cGMPBy similarity1
Binding sitei499cGMPBy similarity1
Active sitei656Proton donorBy similarity1
Metal bindingi660Divalent metal cation 1Combined sources3 Publications1
Metal bindingi696Divalent metal cation 1Combined sources3 Publications1
Metal bindingi697Divalent metal cation 1Combined sources3 Publications1
Metal bindingi697Divalent metal cation 2Combined sources3 Publications1
Binding sitei697Substrate1
Metal bindingi808Divalent metal cation 1Combined sources3 Publications1
Binding sitei808Substrate1

GO - Molecular functioni

  • 3',5'-cyclic-AMP phosphodiesterase activity Source: UniProtKB
  • 3',5'-cyclic-GMP phosphodiesterase activity Source: UniProtKB
  • calcium channel activity Source: UniProtKB
  • cAMP binding Source: UniProtKB
  • cGMP binding Source: UniProtKB
  • cGMP-stimulated cyclic-nucleotide phosphodiesterase activity Source: UniProtKB
  • drug binding Source: UniProtKB
  • identical protein binding Source: IntAct
  • metal ion binding Source: UniProtKB-KW
  • protein homodimerization activity Source: UniProtKB
  • TPR domain binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionHydrolase
LigandcAMP, cGMP, cGMP-binding, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi3.1.4.17 2681
ReactomeiR-HSA-418457 cGMP effects
R-HSA-418555 G alpha (s) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
cGMP-dependent 3',5'-cyclic phosphodiesterase (EC:3.1.4.17)
Alternative name(s):
Cyclic GMP-stimulated phosphodiesterase
Short name:
CGS-PDE
Short name:
cGSPDE
Gene namesi
Name:PDE2A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000186642.15
HGNCiHGNC:8777 PDE2A
MIMi602658 gene
neXtProtiNX_O00408

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Mitochondrion, Mitochondrion inner membrane, Mitochondrion outer membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi5138
OpenTargetsiENSG00000186642
PharmGKBiPA33125

Chemistry databases

ChEMBLiCHEMBL2652
DrugBankiDB07954 3-isobutyl-1-methyl-7H-xanthine
DB00201 Caffeine
DB02315 Cyclic Guanosine Monophosphate
DB05142 ND7001
DB08811 Tofisopam
GuidetoPHARMACOLOGYi1297

Polymorphism and mutation databases

BioMutaiPDE2A

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00001987962 – 941cGMP-dependent 3',5'-cyclic phosphodiesteraseAdd BLAST940

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycine2 Publications1
Lipidationi5S-palmitoyl cysteine1 Publication1
Lipidationi11S-palmitoyl cysteine1 Publication1

Keywords - PTMi

Lipoprotein, Myristate, Palmitate

Proteomic databases

MaxQBiO00408
PaxDbiO00408
PeptideAtlasiO00408
PRIDEiO00408
ProteomicsDBi47868
47869 [O00408-4]

PTM databases

iPTMnetiO00408
PhosphoSitePlusiO00408
SwissPalmiO00408

Expressioni

Tissue specificityi

Expressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas.

Gene expression databases

BgeeiENSG00000186642 Expressed in 183 organ(s), highest expression level in right frontal lobe
CleanExiHS_PDE2A
ExpressionAtlasiO00408 baseline and differential
GenevisibleiO00408 HS

Organism-specific databases

HPAiCAB009752
HPA031192

Interactioni

Subunit structurei

Homodimer.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
AIPO001706EBI-1785967,EBI-704197

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111164, 3 interactors
DIPiDIP-40269N
ELMiO00408
IntActiO00408, 3 interactors
STRINGi9606.ENSP00000334910

Chemistry databases

BindingDBiO00408

Structurei

Secondary structure

1941
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO00408
SMRiO00408
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO00408

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini241 – 377GAF 1Sequence analysisAdd BLAST137
Domaini409 – 548GAF 2Sequence analysisAdd BLAST140
Domaini578 – 902PDEasePROSITE-ProRule annotationAdd BLAST325

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni656 – 660Substrate binding5

Domaini

GAF 1 functions as a dimerization domain, whereas GAF 2 binds cGMP, which causes activation of the catalytic activity of the enzyme.By similarity

Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3689 Eukaryota
ENOG410XRI7 LUCA
GeneTreeiENSGT00760000119066
HOGENOMiHOG000007068
HOVERGENiHBG053540
KOiK18283
OMAiNREQWTK
OrthoDBiEOG091G0L2F
PhylomeDBiO00408
TreeFamiTF316499

Family and domain databases

CDDicd00077 HDc, 1 hit
Gene3Di1.10.1300.10, 1 hit
3.30.450.40, 2 hits
InterProiView protein in InterPro
IPR003018 GAF
IPR029016 GAF-like_dom_sf
IPR003607 HD/PDEase_dom
IPR023088 PDEase
IPR002073 PDEase_catalytic_dom
IPR036971 PDEase_catalytic_dom_sf
IPR023174 PDEase_CS
PfamiView protein in Pfam
PF01590 GAF, 1 hit
PF13185 GAF_2, 1 hit
PF00233 PDEase_I, 1 hit
PRINTSiPR00387 PDIESTERASE1
SMARTiView protein in SMART
SM00065 GAF, 2 hits
SM00471 HDc, 1 hit
PROSITEiView protein in PROSITE
PS00126 PDEASE_I_1, 1 hit
PS51845 PDEASE_I_2, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. Experimental confirmation may be lacking for some isoforms.

This entry has 6 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform PDE2A3 (identifier: O00408-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGQACGHSIL CRSQQYPAAR PAEPRGQQVF LKPDEPPPPP QPCADSLQDA
60 70 80 90 100
LLSLGSVIDI SGLQRAVKEA LSAVLPRVET VYTYLLDGES QLVCEDPPHE
110 120 130 140 150
LPQEGKVREA IISQKRLGCN GLGFSDLPGK PLARLVAPLA PDTQVLVMPL
160 170 180 190 200
ADKEAGAVAA VILVHCGQLS DNEEWSLQAV EKHTLVALRR VQVLQQRGPR
210 220 230 240 250
EAPRAVQNPP EGTAEDQKGG AAYTDRDRKI LQLCGELYDL DASSLQLKVL
260 270 280 290 300
QYLQQETRAS RCCLLLVSED NLQLSCKVIG DKVLGEEVSF PLTGCLGQVV
310 320 330 340 350
EDKKSIQLKD LTSEDVQQLQ SMLGCELQAM LCVPVISRAT DQVVALACAF
360 370 380 390 400
NKLEGDLFTD EDEHVIQHCF HYTSTVLTST LAFQKEQKLK CECQALLQVA
410 420 430 440 450
KNLFTHLDDV SVLLQEIITE ARNLSNAEIC SVFLLDQNEL VAKVFDGGVV
460 470 480 490 500
DDESYEIRIP ADQGIAGHVA TTGQILNIPD AYAHPLFYRG VDDSTGFRTR
510 520 530 540 550
NILCFPIKNE NQEVIGVAEL VNKINGPWFS KFDEDLATAF SIYCGISIAH
560 570 580 590 600
SLLYKKVNEA QYRSHLANEM MMYHMKVSDD EYTKLLHDGI QPVAAIDSNF
610 620 630 640 650
ASFTYTPRSL PEDDTSMAIL SMLQDMNFIN NYKIDCPTLA RFCLMVKKGY
660 670 680 690 700
RDPPYHNWMH AFSVSHFCYL LYKNLELTNY LEDIEIFALF ISCMCHDLDH
710 720 730 740 750
RGTNNSFQVA SKSVLAALYS SEGSVMERHH FAQAIAILNT HGCNIFDHFS
760 770 780 790 800
RKDYQRMLDL MRDIILATDL AHHLRIFKDL QKMAEVGYDR NNKQHHRLLL
810 820 830 840 850
CLLMTSCDLS DQTKGWKTTR KIAELIYKEF FSQGDLEKAM GNRPMEMMDR
860 870 880 890 900
EKAYIPELQI SFMEHIAMPI YKLLQDLFPK AAELYERVAS NREHWTKVSH
910 920 930 940
KFTIRGLPSN NSLDFLDEEY EVPDLDGTRA PINGCCSLDA E
Length:941
Mass (Da):105,717
Last modified:July 1, 1997 - v1
Checksum:i9797609B487FD64E
GO
Isoform PDE2A1 (identifier: O00408-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQ → MRRQPAASLDPLAKEPGPPGSRDDRLE

Note: Soluble form.
Show »
Length:920
Mass (Da):103,478
Checksum:iCF77ED12741349C0
GO
Isoform PDE2A2 (identifier: O00408-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MGQACGHSILCRSQQYPAARPAEP → MVLVLHHILIAVVQFLR

Note: Contains a transit peptide at positions 1-17.
Show »
Length:934
Mass (Da):105,147
Checksum:i2C1E4885AD13F504
GO
Isoform PDE2A4 (identifier: O00408-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MGQACGHSILCRSQQYPAARPAEP → MKKQRIQEGKSLAHR

Show »
Length:932
Mass (Da):104,955
Checksum:i9F5CE92BA3C2E2E5
GO
Isoform 5 (identifier: O00408-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MGQACGHSILCRSQQYPAARPAEP → MVLVLHHILIAVVQFLR
     109-357: Missing.

Note: No experimental confirmation available.
Show »
Length:685
Mass (Da):78,177
Checksum:iA6087394B98221C3
GO
Isoform 6 (identifier: O00408-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQ → MRRQPAASLDPLAKEPGPPGSRDDRLE
     750-807: SRKDYQRMLD...LLLCLLMTSC → PLRTTTILMV...DPRTGRQAQV
     808-941: Missing.

Note: No experimental confirmation available.
Show »
Length:786
Mass (Da):87,235
Checksum:i33190E63C6351001
GO

Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PEF1E9PEF1_HUMAN
Phosphodiesterase
PDE2A
826Annotation score:
H7C009H7C009_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
327Annotation score:
F5GXX2F5GXX2_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
178Annotation score:
C9JPD5C9JPD5_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
197Annotation score:
F5H3Z7F5H3Z7_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
106Annotation score:
F5H143F5H143_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
92Annotation score:
F5H2R8F5H2R8_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
65Annotation score:
H0YFL1H0YFL1_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
336Annotation score:
H0YG13H0YG13_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
172Annotation score:
F5H5P8F5H5P8_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
86Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence AAS75515 differs from that shown. Reason: Frameshift at position 48.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti38P → L in AAS75513 (Ref. 2) Curated1
Sequence conflicti99H → R in BAG35343 (PubMed:14702039).Curated1
Sequence conflicti213T → A in AAS75513 (Ref. 2) Curated1
Sequence conflicti664V → A in AAS75513 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024170224T → I. Corresponds to variant dbSNP:rs341047Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0553151 – 48MGQAC…ADSLQ → MRRQPAASLDPLAKEPGPPG SRDDRLE in isoform PDE2A1 and isoform 6. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_0553161 – 24MGQAC…RPAEP → MVLVLHHILIAVVQFLR in isoform PDE2A2 and isoform 5. 2 PublicationsAdd BLAST24
Alternative sequenceiVSP_0553171 – 24MGQAC…RPAEP → MKKQRIQEGKSLAHR in isoform PDE2A4. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_055318109 – 357Missing in isoform 5. 1 PublicationAdd BLAST249
Alternative sequenceiVSP_055319750 – 807SRKDY…LMTSC → PLRTTTILMVGLGPGGYRGP RKKLPEGQLSALQRGALGRS RMGLMGRRDPRTGRQAQV in isoform 6. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_055320808 – 941Missing in isoform 6. 1 PublicationAdd BLAST134

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U67733 mRNA Translation: AAC51320.1
AY495087 mRNA Translation: AAS75513.1
AY495088 mRNA Translation: AAS75514.1
AY495089 mRNA Translation: AAS75515.1 Frameshift.
AK092278 mRNA Translation: BAG52517.1
AK131525 mRNA Translation: BAD18664.1
AK312434 mRNA Translation: BAG35343.1
AP003065 Genomic DNA No translation available.
AP005019 Genomic DNA No translation available.
CCDSiCCDS44670.1 [O00408-3]
CCDS53678.1 [O00408-4]
CCDS73345.1 [O00408-2]
CCDS8216.1 [O00408-1]
RefSeqiNP_001137311.1, NM_001143839.3 [O00408-3]
NP_001139681.1, NM_001146209.2 [O00408-4]
NP_001230713.1, NM_001243784.1 [O00408-2]
NP_002590.1, NM_002599.4 [O00408-1]
UniGeneiHs.503163

Genome annotation databases

EnsembliENST00000334456; ENSP00000334910; ENSG00000186642 [O00408-1]
ENST00000376450; ENSP00000365633; ENSG00000186642 [O00408-5]
ENST00000444035; ENSP00000411657; ENSG00000186642 [O00408-2]
ENST00000540345; ENSP00000446399; ENSG00000186642 [O00408-4]
ENST00000544570; ENSP00000442256; ENSG00000186642 [O00408-3]
GeneIDi5138
KEGGihsa:5138
UCSCiuc001osn.4 human [O00408-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U67733 mRNA Translation: AAC51320.1
AY495087 mRNA Translation: AAS75513.1
AY495088 mRNA Translation: AAS75514.1
AY495089 mRNA Translation: AAS75515.1 Frameshift.
AK092278 mRNA Translation: BAG52517.1
AK131525 mRNA Translation: BAD18664.1
AK312434 mRNA Translation: BAG35343.1
AP003065 Genomic DNA No translation available.
AP005019 Genomic DNA No translation available.
CCDSiCCDS44670.1 [O00408-3]
CCDS53678.1 [O00408-4]
CCDS73345.1 [O00408-2]
CCDS8216.1 [O00408-1]
RefSeqiNP_001137311.1, NM_001143839.3 [O00408-3]
NP_001139681.1, NM_001146209.2 [O00408-4]
NP_001230713.1, NM_001243784.1 [O00408-2]
NP_002590.1, NM_002599.4 [O00408-1]
UniGeneiHs.503163

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1Z1LX-ray1.70A578-919[»]
3IBJX-ray3.02A/B215-900[»]
3ITMX-ray2.49A/B/C/D579-919[»]
3ITUX-ray1.58A/B/C/D579-919[»]
4C1IX-ray2.40A/B/C/D578-921[»]
4D08X-ray1.90A/B/C/D578-921[»]
4D09X-ray2.50A/B/C/D578-921[»]
4HTXX-ray1.90A/B/C/D578-919[»]
4HTZX-ray2.00A/B/C/D578-919[»]
4JIBX-ray1.72A/B/C/D579-919[»]
5TZ3X-ray1.72A/B/C/D579-919[»]
5TZAX-ray1.70A/B/C/D579-919[»]
5TZCX-ray2.36A/B/C/D579-919[»]
5TZHX-ray1.60A/B/C/D579-919[»]
5TZWX-ray1.59A/B/C/D579-919[»]
5TZXX-ray1.90A/B/C/D579-919[»]
5TZZX-ray1.60A/B/C/D579-919[»]
5U00X-ray1.41A/B/C/D579-919[»]
5U7DX-ray1.75A/B/C579-919[»]
5U7IX-ray2.00A/B/C/D579-919[»]
5U7JX-ray1.90A/B/C/D579-919[»]
5U7KX-ray2.06A/B/C/D579-919[»]
5U7LX-ray2.38A/B/C579-919[»]
5VP0X-ray2.20A/B/C578-919[»]
5VP1X-ray1.86A/B/C578-919[»]
5XKMX-ray2.16A/B/C/D/E/F578-919[»]
6B96X-ray1.88A/B578-919[»]
6B97X-ray1.76A/B578-919[»]
6B98X-ray1.97A/B578-919[»]
6C7DX-ray1.79A/B/C/D579-917[»]
6C7EX-ray1.43A/B/C/D579-917[»]
6C7FX-ray1.82A/B/C579-917[»]
6C7GX-ray1.68A/B/C/D579-917[»]
6C7IX-ray1.71A/B/C/D579-917[»]
6C7JX-ray1.85A/B/C/D579-917[»]
ProteinModelPortaliO00408
SMRiO00408
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111164, 3 interactors
DIPiDIP-40269N
ELMiO00408
IntActiO00408, 3 interactors
STRINGi9606.ENSP00000334910

Chemistry databases

BindingDBiO00408
ChEMBLiCHEMBL2652
DrugBankiDB07954 3-isobutyl-1-methyl-7H-xanthine
DB00201 Caffeine
DB02315 Cyclic Guanosine Monophosphate
DB05142 ND7001
DB08811 Tofisopam
GuidetoPHARMACOLOGYi1297

PTM databases

iPTMnetiO00408
PhosphoSitePlusiO00408
SwissPalmiO00408

Polymorphism and mutation databases

BioMutaiPDE2A

Proteomic databases

MaxQBiO00408
PaxDbiO00408
PeptideAtlasiO00408
PRIDEiO00408
ProteomicsDBi47868
47869 [O00408-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334456; ENSP00000334910; ENSG00000186642 [O00408-1]
ENST00000376450; ENSP00000365633; ENSG00000186642 [O00408-5]
ENST00000444035; ENSP00000411657; ENSG00000186642 [O00408-2]
ENST00000540345; ENSP00000446399; ENSG00000186642 [O00408-4]
ENST00000544570; ENSP00000442256; ENSG00000186642 [O00408-3]
GeneIDi5138
KEGGihsa:5138
UCSCiuc001osn.4 human [O00408-1]

Organism-specific databases

CTDi5138
DisGeNETi5138
EuPathDBiHostDB:ENSG00000186642.15
GeneCardsiPDE2A
HGNCiHGNC:8777 PDE2A
HPAiCAB009752
HPA031192
MIMi602658 gene
neXtProtiNX_O00408
OpenTargetsiENSG00000186642
PharmGKBiPA33125
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3689 Eukaryota
ENOG410XRI7 LUCA
GeneTreeiENSGT00760000119066
HOGENOMiHOG000007068
HOVERGENiHBG053540
KOiK18283
OMAiNREQWTK
OrthoDBiEOG091G0L2F
PhylomeDBiO00408
TreeFamiTF316499

Enzyme and pathway databases

BRENDAi3.1.4.17 2681
ReactomeiR-HSA-418457 cGMP effects
R-HSA-418555 G alpha (s) signalling events

Miscellaneous databases

ChiTaRSiPDE2A human
EvolutionaryTraceiO00408
GeneWikiiPDE2A
GenomeRNAii5138
PROiPR:O00408
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000186642 Expressed in 183 organ(s), highest expression level in right frontal lobe
CleanExiHS_PDE2A
ExpressionAtlasiO00408 baseline and differential
GenevisibleiO00408 HS

Family and domain databases

CDDicd00077 HDc, 1 hit
Gene3Di1.10.1300.10, 1 hit
3.30.450.40, 2 hits
InterProiView protein in InterPro
IPR003018 GAF
IPR029016 GAF-like_dom_sf
IPR003607 HD/PDEase_dom
IPR023088 PDEase
IPR002073 PDEase_catalytic_dom
IPR036971 PDEase_catalytic_dom_sf
IPR023174 PDEase_CS
PfamiView protein in Pfam
PF01590 GAF, 1 hit
PF13185 GAF_2, 1 hit
PF00233 PDEase_I, 1 hit
PRINTSiPR00387 PDIESTERASE1
SMARTiView protein in SMART
SM00065 GAF, 2 hits
SM00471 HDc, 1 hit
PROSITEiView protein in PROSITE
PS00126 PDEASE_I_1, 1 hit
PS51845 PDEASE_I_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPDE2A_HUMAN
AccessioniPrimary (citable) accession number: O00408
Secondary accession number(s): B2R646
, B3KRV5, E9PGI1, F6W5Z0, Q5J791, Q5J792, Q5J793, Q6ZMR1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 1, 1997
Last modified: October 10, 2018
This is version 167 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again