Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 174 (31 Jul 2019)
Sequence version 1 (01 Jul 1997)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

cGMP-dependent 3',5'-cyclic phosphodiesterase

Gene

PDE2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Plays an important role in growth and invasion of malignant melanoma cells (e.g. pseudomyxoma peritonei (PMP) cell line) (PubMed:24705027).1 Publication
Isoform PDE2A2: Regulates mitochondrial cAMP levels and respiration (By similarity). Involved in the regulation of mitochondria morphology/dynamics and apoptotic cell death via local modulation of cAMP/PKA signaling in the mitochondrion, including the monitoring of local cAMP levels at the outer mitochondrial membrane and of PKA-dependent phosphorylation of DNM1L (PubMed:28463107).By similarity1 Publication

Miscellaneous

cGMP binds at an allosteric activator site.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei431cGMPBy similarity1
Binding sitei446cGMPBy similarity1
Binding sitei499cGMPBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei656Proton donorBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi660Divalent metal cation 1Combined sources3 Publications1
Metal bindingi696Divalent metal cation 1Combined sources3 Publications1
Metal bindingi697Divalent metal cation 1Combined sources3 Publications1
Metal bindingi697Divalent metal cation 2Combined sources3 Publications1
Binding sitei697Substrate1
Metal bindingi808Divalent metal cation 1Combined sources3 Publications1
Binding sitei808Substrate1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandcAMP, cGMP, cGMP-binding, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.4.17 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-418457 cGMP effects
R-HSA-418555 G alpha (s) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
cGMP-dependent 3',5'-cyclic phosphodiesterase (EC:3.1.4.17)
Alternative name(s):
Cyclic GMP-stimulated phosphodiesterase
Short name:
CGS-PDE
Short name:
cGSPDE
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PDE2A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8777 PDE2A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602658 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O00408

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Mitochondrion, Mitochondrion inner membrane, Mitochondrion outer membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
5138

Open Targets

More...
OpenTargetsi
ENSG00000186642

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33125

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2652

Drug and drug target database

More...
DrugBanki
DB07954 3-isobutyl-1-methyl-7H-xanthine
DB00201 Caffeine
DB02315 Cyclic Guanosine Monophosphate
DB05142 ND7001
DB08811 Tofisopam

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1297

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PDE2A

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001987962 – 941cGMP-dependent 3',5'-cyclic phosphodiesteraseAdd BLAST940

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycine2 Publications1
Lipidationi5S-palmitoyl cysteine1 Publication1
Lipidationi11S-palmitoyl cysteine1 Publication1

Keywords - PTMi

Lipoprotein, Myristate, Palmitate

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O00408

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O00408

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O00408

PeptideAtlas

More...
PeptideAtlasi
O00408

PRoteomics IDEntifications database

More...
PRIDEi
O00408

ProteomicsDB human proteome resource

More...
ProteomicsDBi
28099
47868 [O00408-1]
47869 [O00408-4]
67904

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O00408

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O00408

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O00408

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186642 Expressed in 183 organ(s), highest expression level in right frontal lobe

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O00408 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O00408 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB009752
HPA031192

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
AIPO001706EBI-1785967,EBI-704197

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111164, 3 interactors

Database of interacting proteins

More...
DIPi
DIP-40269N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
O00408

Protein interaction database and analysis system

More...
IntActi
O00408, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000334910

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O00408

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1941
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O00408

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O00408

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini241 – 377GAF 1Sequence analysisAdd BLAST137
Domaini409 – 548GAF 2Sequence analysisAdd BLAST140
Domaini578 – 902PDEasePROSITE-ProRule annotationAdd BLAST325

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni656 – 660Substrate binding5

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

GAF 1 functions as a dimerization domain, whereas GAF 2 binds cGMP, which causes activation of the catalytic activity of the enzyme.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3689 Eukaryota
ENOG410XRI7 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159817

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007068

KEGG Orthology (KO)

More...
KOi
K18283

Identification of Orthologs from Complete Genome Data

More...
OMAi
SMLGCEV

Database of Orthologous Groups

More...
OrthoDBi
904682at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O00408

TreeFam database of animal gene trees

More...
TreeFami
TF316499

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00077 HDc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1300.10, 1 hit
3.30.450.40, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003018 GAF
IPR029016 GAF-like_dom_sf
IPR003607 HD/PDEase_dom
IPR023088 PDEase
IPR002073 PDEase_catalytic_dom
IPR036971 PDEase_catalytic_dom_sf
IPR023174 PDEase_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01590 GAF, 1 hit
PF13185 GAF_2, 1 hit
PF00233 PDEase_I, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00387 PDIESTERASE1

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00065 GAF, 2 hits
SM00471 HDc, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00126 PDEASE_I_1, 1 hit
PS51845 PDEASE_I_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. Experimental confirmation may be lacking for some isoforms.

This entry has 6 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform PDE2A3 (identifier: O00408-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGQACGHSIL CRSQQYPAAR PAEPRGQQVF LKPDEPPPPP QPCADSLQDA
60 70 80 90 100
LLSLGSVIDI SGLQRAVKEA LSAVLPRVET VYTYLLDGES QLVCEDPPHE
110 120 130 140 150
LPQEGKVREA IISQKRLGCN GLGFSDLPGK PLARLVAPLA PDTQVLVMPL
160 170 180 190 200
ADKEAGAVAA VILVHCGQLS DNEEWSLQAV EKHTLVALRR VQVLQQRGPR
210 220 230 240 250
EAPRAVQNPP EGTAEDQKGG AAYTDRDRKI LQLCGELYDL DASSLQLKVL
260 270 280 290 300
QYLQQETRAS RCCLLLVSED NLQLSCKVIG DKVLGEEVSF PLTGCLGQVV
310 320 330 340 350
EDKKSIQLKD LTSEDVQQLQ SMLGCELQAM LCVPVISRAT DQVVALACAF
360 370 380 390 400
NKLEGDLFTD EDEHVIQHCF HYTSTVLTST LAFQKEQKLK CECQALLQVA
410 420 430 440 450
KNLFTHLDDV SVLLQEIITE ARNLSNAEIC SVFLLDQNEL VAKVFDGGVV
460 470 480 490 500
DDESYEIRIP ADQGIAGHVA TTGQILNIPD AYAHPLFYRG VDDSTGFRTR
510 520 530 540 550
NILCFPIKNE NQEVIGVAEL VNKINGPWFS KFDEDLATAF SIYCGISIAH
560 570 580 590 600
SLLYKKVNEA QYRSHLANEM MMYHMKVSDD EYTKLLHDGI QPVAAIDSNF
610 620 630 640 650
ASFTYTPRSL PEDDTSMAIL SMLQDMNFIN NYKIDCPTLA RFCLMVKKGY
660 670 680 690 700
RDPPYHNWMH AFSVSHFCYL LYKNLELTNY LEDIEIFALF ISCMCHDLDH
710 720 730 740 750
RGTNNSFQVA SKSVLAALYS SEGSVMERHH FAQAIAILNT HGCNIFDHFS
760 770 780 790 800
RKDYQRMLDL MRDIILATDL AHHLRIFKDL QKMAEVGYDR NNKQHHRLLL
810 820 830 840 850
CLLMTSCDLS DQTKGWKTTR KIAELIYKEF FSQGDLEKAM GNRPMEMMDR
860 870 880 890 900
EKAYIPELQI SFMEHIAMPI YKLLQDLFPK AAELYERVAS NREHWTKVSH
910 920 930 940
KFTIRGLPSN NSLDFLDEEY EVPDLDGTRA PINGCCSLDA E
Length:941
Mass (Da):105,717
Last modified:July 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9797609B487FD64E
GO
Isoform PDE2A1 (identifier: O00408-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQ → MRRQPAASLDPLAKEPGPPGSRDDRLE

Note: Soluble form.
Show »
Length:920
Mass (Da):103,478
Checksum:iCF77ED12741349C0
GO
Isoform PDE2A2 (identifier: O00408-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MGQACGHSILCRSQQYPAARPAEP → MVLVLHHILIAVVQFLR

Note: Contains a transit peptide at positions 1-17.
Show »
Length:934
Mass (Da):105,147
Checksum:i2C1E4885AD13F504
GO
Isoform PDE2A4 (identifier: O00408-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MGQACGHSILCRSQQYPAARPAEP → MKKQRIQEGKSLAHR

Show »
Length:932
Mass (Da):104,955
Checksum:i9F5CE92BA3C2E2E5
GO
Isoform 5 (identifier: O00408-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MGQACGHSILCRSQQYPAARPAEP → MVLVLHHILIAVVQFLR
     109-357: Missing.

Note: No experimental confirmation available.
Show »
Length:685
Mass (Da):78,177
Checksum:iA6087394B98221C3
GO
Isoform 6 (identifier: O00408-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQ → MRRQPAASLDPLAKEPGPPGSRDDRLE
     750-807: SRKDYQRMLD...LLLCLLMTSC → PLRTTTILMV...DPRTGRQAQV
     808-941: Missing.

Note: No experimental confirmation available.
Show »
Length:786
Mass (Da):87,235
Checksum:i33190E63C6351001
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PEF1E9PEF1_HUMAN
Phosphodiesterase
PDE2A
826Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C009H7C009_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
327Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JPD5C9JPD5_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
197Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GXX2F5GXX2_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H2R8F5H2R8_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
65Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFL1H0YFL1_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
336Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H2V7F5H2V7_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H1D7F5H1D7_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGL2H0YGL2_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H3Z7F5H3Z7_HUMAN
cGMP-dependent 3',5'-cyclic phospho...
PDE2A
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAS75515 differs from that shown. Reason: Frameshift at position 48.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti38P → L in AAS75513 (Ref. 2) Curated1
Sequence conflicti99H → R in BAG35343 (PubMed:14702039).Curated1
Sequence conflicti213T → A in AAS75513 (Ref. 2) Curated1
Sequence conflicti664V → A in AAS75513 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_024170224T → I. Corresponds to variant dbSNP:rs341047Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0553151 – 48MGQAC…ADSLQ → MRRQPAASLDPLAKEPGPPG SRDDRLE in isoform PDE2A1 and isoform 6. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_0553161 – 24MGQAC…RPAEP → MVLVLHHILIAVVQFLR in isoform PDE2A2 and isoform 5. 2 PublicationsAdd BLAST24
Alternative sequenceiVSP_0553171 – 24MGQAC…RPAEP → MKKQRIQEGKSLAHR in isoform PDE2A4. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_055318109 – 357Missing in isoform 5. 1 PublicationAdd BLAST249
Alternative sequenceiVSP_055319750 – 807SRKDY…LMTSC → PLRTTTILMVGLGPGGYRGP RKKLPEGQLSALQRGALGRS RMGLMGRRDPRTGRQAQV in isoform 6. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_055320808 – 941Missing in isoform 6. 1 PublicationAdd BLAST134

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U67733 mRNA Translation: AAC51320.1
AY495087 mRNA Translation: AAS75513.1
AY495088 mRNA Translation: AAS75514.1
AY495089 mRNA Translation: AAS75515.1 Frameshift.
AK092278 mRNA Translation: BAG52517.1
AK131525 mRNA Translation: BAD18664.1
AK312434 mRNA Translation: BAG35343.1
AP003065 Genomic DNA No translation available.
AP005019 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44670.1 [O00408-3]
CCDS53678.1 [O00408-4]
CCDS73345.1 [O00408-2]
CCDS8216.1 [O00408-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001137311.1, NM_001143839.3 [O00408-3]
NP_001139681.1, NM_001146209.2 [O00408-4]
NP_001230713.1, NM_001243784.1 [O00408-2]
NP_002590.1, NM_002599.4 [O00408-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000334456; ENSP00000334910; ENSG00000186642 [O00408-1]
ENST00000376450; ENSP00000365633; ENSG00000186642 [O00408-5]
ENST00000444035; ENSP00000411657; ENSG00000186642 [O00408-2]
ENST00000540345; ENSP00000446399; ENSG00000186642 [O00408-4]
ENST00000544570; ENSP00000442256; ENSG00000186642 [O00408-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5138

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5138

UCSC genome browser

More...
UCSCi
uc001osn.4 human [O00408-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U67733 mRNA Translation: AAC51320.1
AY495087 mRNA Translation: AAS75513.1
AY495088 mRNA Translation: AAS75514.1
AY495089 mRNA Translation: AAS75515.1 Frameshift.
AK092278 mRNA Translation: BAG52517.1
AK131525 mRNA Translation: BAD18664.1
AK312434 mRNA Translation: BAG35343.1
AP003065 Genomic DNA No translation available.
AP005019 Genomic DNA No translation available.
CCDSiCCDS44670.1 [O00408-3]
CCDS53678.1 [O00408-4]
CCDS73345.1 [O00408-2]
CCDS8216.1 [O00408-1]
RefSeqiNP_001137311.1, NM_001143839.3 [O00408-3]
NP_001139681.1, NM_001146209.2 [O00408-4]
NP_001230713.1, NM_001243784.1 [O00408-2]
NP_002590.1, NM_002599.4 [O00408-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1Z1LX-ray1.70A578-919[»]
3IBJX-ray3.02A/B215-900[»]
3ITMX-ray2.49A/B/C/D579-919[»]
3ITUX-ray1.58A/B/C/D579-919[»]
4C1IX-ray2.40A/B/C/D578-921[»]
4D08X-ray1.90A/B/C/D578-921[»]
4D09X-ray2.50A/B/C/D578-921[»]
4HTXX-ray1.90A/B/C/D578-919[»]
4HTZX-ray2.00A/B/C/D578-919[»]
4JIBX-ray1.72A/B/C/D579-919[»]
5TZ3X-ray1.72A/B/C/D579-919[»]
5TZAX-ray1.70A/B/C/D579-919[»]
5TZCX-ray2.36A/B/C/D579-919[»]
5TZHX-ray1.60A/B/C/D579-919[»]
5TZWX-ray1.59A/B/C/D579-919[»]
5TZXX-ray1.90A/B/C/D579-919[»]
5TZZX-ray1.60A/B/C/D579-919[»]
5U00X-ray1.41A/B/C/D579-919[»]
5U7DX-ray1.75A/B/C579-919[»]
5U7IX-ray2.00A/B/C/D579-919[»]
5U7JX-ray1.90A/B/C/D579-919[»]
5U7KX-ray2.06A/B/C/D579-919[»]
5U7LX-ray2.38A/B/C579-919[»]
5VP0X-ray2.20A/B/C578-919[»]
5VP1X-ray1.86A/B/C578-919[»]
5XKMX-ray2.16A/B/C/D/E/F578-919[»]
6B96X-ray1.88A/B578-919[»]
6B97X-ray1.76A/B578-919[»]
6B98X-ray1.97A/B578-919[»]
6BLFX-ray2.11A/B578-919[»]
6C7DX-ray1.79A/B/C/D579-917[»]
6C7EX-ray1.43A/B/C/D579-917[»]
6C7FX-ray1.82A/B/C579-917[»]
6C7GX-ray1.68A/B/C/D579-917[»]
6C7IX-ray1.71A/B/C/D579-917[»]
6C7JX-ray1.85A/B/C/D579-917[»]
6CYBX-ray1.62A/B578-919[»]
6CYCX-ray1.54A/B578-919[»]
6CYDX-ray1.69A/B578-919[»]
SMRiO00408
ModBaseiSearch...

Protein-protein interaction databases

BioGridi111164, 3 interactors
DIPiDIP-40269N
ELMiO00408
IntActiO00408, 5 interactors
STRINGi9606.ENSP00000334910

Chemistry databases

BindingDBiO00408
ChEMBLiCHEMBL2652
DrugBankiDB07954 3-isobutyl-1-methyl-7H-xanthine
DB00201 Caffeine
DB02315 Cyclic Guanosine Monophosphate
DB05142 ND7001
DB08811 Tofisopam
GuidetoPHARMACOLOGYi1297

PTM databases

iPTMnetiO00408
PhosphoSitePlusiO00408
SwissPalmiO00408

Polymorphism and mutation databases

BioMutaiPDE2A

Proteomic databases

jPOSTiO00408
MaxQBiO00408
PaxDbiO00408
PeptideAtlasiO00408
PRIDEiO00408
ProteomicsDBi28099
47868 [O00408-1]
47869 [O00408-4]
67904

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334456; ENSP00000334910; ENSG00000186642 [O00408-1]
ENST00000376450; ENSP00000365633; ENSG00000186642 [O00408-5]
ENST00000444035; ENSP00000411657; ENSG00000186642 [O00408-2]
ENST00000540345; ENSP00000446399; ENSG00000186642 [O00408-4]
ENST00000544570; ENSP00000442256; ENSG00000186642 [O00408-3]
GeneIDi5138
KEGGihsa:5138
UCSCiuc001osn.4 human [O00408-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5138
DisGeNETi5138

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PDE2A
HGNCiHGNC:8777 PDE2A
HPAiCAB009752
HPA031192
MIMi602658 gene
neXtProtiNX_O00408
OpenTargetsiENSG00000186642
PharmGKBiPA33125

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3689 Eukaryota
ENOG410XRI7 LUCA
GeneTreeiENSGT00940000159817
HOGENOMiHOG000007068
KOiK18283
OMAiSMLGCEV
OrthoDBi904682at2759
PhylomeDBiO00408
TreeFamiTF316499

Enzyme and pathway databases

BRENDAi3.1.4.17 2681
ReactomeiR-HSA-418457 cGMP effects
R-HSA-418555 G alpha (s) signalling events

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PDE2A human
EvolutionaryTraceiO00408

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PDE2A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5138

Protein Ontology

More...
PROi
PR:O00408

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000186642 Expressed in 183 organ(s), highest expression level in right frontal lobe
ExpressionAtlasiO00408 baseline and differential
GenevisibleiO00408 HS

Family and domain databases

CDDicd00077 HDc, 1 hit
Gene3Di1.10.1300.10, 1 hit
3.30.450.40, 2 hits
InterProiView protein in InterPro
IPR003018 GAF
IPR029016 GAF-like_dom_sf
IPR003607 HD/PDEase_dom
IPR023088 PDEase
IPR002073 PDEase_catalytic_dom
IPR036971 PDEase_catalytic_dom_sf
IPR023174 PDEase_CS
PfamiView protein in Pfam
PF01590 GAF, 1 hit
PF13185 GAF_2, 1 hit
PF00233 PDEase_I, 1 hit
PRINTSiPR00387 PDIESTERASE1
SMARTiView protein in SMART
SM00065 GAF, 2 hits
SM00471 HDc, 1 hit
PROSITEiView protein in PROSITE
PS00126 PDEASE_I_1, 1 hit
PS51845 PDEASE_I_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPDE2A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00408
Secondary accession number(s): B2R646
, B3KRV5, E9PGI1, F6W5Z0, Q5J791, Q5J792, Q5J793, Q6ZMR1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 1, 1997
Last modified: July 31, 2019
This is version 174 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again