Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfotransferase 1C2

Gene

SULT1C2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. May be involved in the activation of carcinogenic hydroxylamines. Shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei109Proton acceptorBy similarity1
Binding sitei131PAPS1
Binding sitei139PAPS1
Binding sitei194PAPS1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi49 – 54PAPS6
Nucleotide bindingi228 – 233PAPS6
Nucleotide bindingi256 – 260PAPS5

GO - Molecular functioni

  • aryl sulfotransferase activity Source: Reactome
  • sulfotransferase activity Source: BHF-UCL

GO - Biological processi

  • 3'-phosphoadenosine 5'-phosphosulfate metabolic process Source: Reactome
  • amine metabolic process Source: ProtInc
  • sulfation Source: BHF-UCL

Keywordsi

Molecular functionTransferase

Enzyme and pathway databases

ReactomeiR-HSA-156584 Cytosolic sulfonation of small molecules

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfotransferase 1C2 (EC:2.8.2.-)
Short name:
ST1C2
Alternative name(s):
Sulfotransferase 1C1
Short name:
SULT1C#1
humSULTC2
Gene namesi
Name:SULT1C2
Synonyms:SULT1C1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000198203.9
HGNCiHGNC:11456 SULT1C2
MIMi602385 gene
neXtProtiNX_O00338

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi6819
OpenTargetsiENSG00000198203
PharmGKBiPA164742557

Chemistry databases

ChEMBLiCHEMBL1743295

Polymorphism and mutation databases

BioMutaiSULT1C2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000851321 – 296Sulfotransferase 1C2Add BLAST296

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei139PhosphoserineBy similarity1
Modified residuei254PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO00338
PeptideAtlasiO00338
PRIDEiO00338
ProteomicsDBi47854
47855 [O00338-2]

PTM databases

iPTMnetiO00338
PhosphoSitePlusiO00338

Expressioni

Tissue specificityi

Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.

Gene expression databases

BgeeiENSG00000198203 Expressed in 140 organ(s), highest expression level in adult mammalian kidney
CleanExiHS_SULT1C2
ExpressionAtlasiO00338 baseline and differential
GenevisibleiO00338 HS

Organism-specific databases

HPAiHPA007190

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TINF2Q9BSI42EBI-3913419,EBI-717399

Protein-protein interaction databases

BioGridi112688, 10 interactors
IntActiO00338, 6 interactors

Structurei

Secondary structure

1296
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO00338
SMRiO00338
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO00338

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni107 – 109Substrate bindingBy similarity3

Sequence similaritiesi

Belongs to the sulfotransferase 1 family.Curated

Phylogenomic databases

GeneTreeiENSGT00760000118932
HOGENOMiHOG000037209
HOVERGENiHBG001195
InParanoidiO00338
KOiK01025
PhylomeDBiO00338
TreeFamiTF321745

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR000863 Sulfotransferase_dom
PfamiView protein in Pfam
PF00685 Sulfotransfer_1, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform Short (identifier: O00338-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALTSDLGKQ IKLKEVEGTL LQPATVDNWS QIQSFEAKPD DLLICTYPKA
60 70 80 90 100
GTTWIQEIVD MIEQNGDVEK CQRAIIQHRH PFIEWARPPQ PSGVEKAKAM
110 120 130 140 150
PSPRILKTHL STQLLPPSFW ENNCKFLYVA RNAKDCMVSY YHFQRMNHML
160 170 180 190 200
PDPGTWEEYF ETFINGKVVW GSWFDHVKGW WEMKDRHQIL FLFYEDIKRD
210 220 230 240 250
PKHEIRKVMQ FMGKKVDETV LDKIVQETSF EKMKENPMTN RSTVSKSILD
260 270 280 290
QSISSFMRKG TVGDWKNHFT VAQNERFDEI YRRKMEGTSI NFCMEL
Length:296
Mass (Da):34,880
Last modified:July 1, 1997 - v1
Checksum:i3DC01C8A8ED61EFD
GO
Isoform Long (identifier: O00338-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-113: GVEKAKAMPSPRILKTHLSTQ → ETGFHHVAQAGLKLLSSSNPPASTSQSAKITD

Show »
Length:307
Mass (Da):35,868
Checksum:iDB83191FA88BFAD1
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JSR0C9JSR0_HUMAN
Sulfotransferase
SULT1C2
130Annotation score:
B4DLP0B4DLP0_HUMAN
Sulfotransferase
SULT1C2
310Annotation score:
B8ZZF7B8ZZF7_HUMAN
Sulfotransferase
SULT1C2
259Annotation score:
H7BZ17H7BZ17_HUMAN
Sulfotransferase
SULT1C2
226Annotation score:
H7C420H7C420_HUMAN
Sulfotransferase
SULT1C2
116Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_021986128Y → H. Corresponds to variant dbSNP:rs17036091Ensembl.1
Natural variantiVAR_021987255S → A. Corresponds to variant dbSNP:rs17036104Ensembl.1
Natural variantiVAR_061888282R → T. Corresponds to variant dbSNP:rs45515691Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00630393 – 113GVEKA…HLSTQ → ETGFHHVAQAGLKLLSSSNP PASTSQSAKITD in isoform Long. CuratedAdd BLAST21

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66036 mRNA Translation: AAC51285.1
AB008164 mRNA Translation: BAA28346.1
AF026303 mRNA Translation: AAC00409.1
AF186251 mRNA Translation: AAF72799.1
AF186252 mRNA Translation: AAF72800.1
AF186253 mRNA Translation: AAF72801.1
AF186254 mRNA Translation: AAF72802.1
AF186255 mRNA Translation: AAF72803.1
AF186256 mRNA Translation: AAF72804.1
AF186262
, AF186258, AF186260, AF186261 Genomic DNA Translation: AAF72805.1
AF186262
, AF186258, AF186259, AF186260, AF186261 Genomic DNA Translation: AAF72806.1
BT006951 mRNA Translation: AAP35597.1
AK313193 mRNA Translation: BAG36010.1
AC019100 Genomic DNA Translation: AAY14790.1
CH471182 Genomic DNA Translation: EAW53889.1
CH471182 Genomic DNA Translation: EAW53890.1
BC005353 mRNA Translation: AAH05353.1
CCDSiCCDS2075.1 [O00338-1]
CCDS2076.1 [O00338-2]
RefSeqiNP_001047.1, NM_001056.3 [O00338-1]
NP_789795.1, NM_176825.2 [O00338-2]
UniGeneiHs.436123

Genome annotation databases

EnsembliENST00000251481; ENSP00000251481; ENSG00000198203 [O00338-1]
ENST00000326853; ENSP00000319622; ENSG00000198203 [O00338-2]
GeneIDi6819
KEGGihsa:6819
UCSCiuc002tdx.3 human [O00338-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66036 mRNA Translation: AAC51285.1
AB008164 mRNA Translation: BAA28346.1
AF026303 mRNA Translation: AAC00409.1
AF186251 mRNA Translation: AAF72799.1
AF186252 mRNA Translation: AAF72800.1
AF186253 mRNA Translation: AAF72801.1
AF186254 mRNA Translation: AAF72802.1
AF186255 mRNA Translation: AAF72803.1
AF186256 mRNA Translation: AAF72804.1
AF186262
, AF186258, AF186260, AF186261 Genomic DNA Translation: AAF72805.1
AF186262
, AF186258, AF186259, AF186260, AF186261 Genomic DNA Translation: AAF72806.1
BT006951 mRNA Translation: AAP35597.1
AK313193 mRNA Translation: BAG36010.1
AC019100 Genomic DNA Translation: AAY14790.1
CH471182 Genomic DNA Translation: EAW53889.1
CH471182 Genomic DNA Translation: EAW53890.1
BC005353 mRNA Translation: AAH05353.1
CCDSiCCDS2075.1 [O00338-1]
CCDS2076.1 [O00338-2]
RefSeqiNP_001047.1, NM_001056.3 [O00338-1]
NP_789795.1, NM_176825.2 [O00338-2]
UniGeneiHs.436123

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3BFXX-ray1.80A/B3-296[»]
ProteinModelPortaliO00338
SMRiO00338
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112688, 10 interactors
IntActiO00338, 6 interactors

Chemistry databases

ChEMBLiCHEMBL1743295

PTM databases

iPTMnetiO00338
PhosphoSitePlusiO00338

Polymorphism and mutation databases

BioMutaiSULT1C2

Proteomic databases

MaxQBiO00338
PeptideAtlasiO00338
PRIDEiO00338
ProteomicsDBi47854
47855 [O00338-2]

Protocols and materials databases

DNASUi6819
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000251481; ENSP00000251481; ENSG00000198203 [O00338-1]
ENST00000326853; ENSP00000319622; ENSG00000198203 [O00338-2]
GeneIDi6819
KEGGihsa:6819
UCSCiuc002tdx.3 human [O00338-1]

Organism-specific databases

CTDi6819
DisGeNETi6819
EuPathDBiHostDB:ENSG00000198203.9
GeneCardsiSULT1C2
HGNCiHGNC:11456 SULT1C2
HPAiHPA007190
MIMi602385 gene
neXtProtiNX_O00338
OpenTargetsiENSG00000198203
PharmGKBiPA164742557
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118932
HOGENOMiHOG000037209
HOVERGENiHBG001195
InParanoidiO00338
KOiK01025
PhylomeDBiO00338
TreeFamiTF321745

Enzyme and pathway databases

ReactomeiR-HSA-156584 Cytosolic sulfonation of small molecules

Miscellaneous databases

EvolutionaryTraceiO00338
GeneWikiiSULT1C2
GenomeRNAii6819
PROiPR:O00338
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000198203 Expressed in 140 organ(s), highest expression level in adult mammalian kidney
CleanExiHS_SULT1C2
ExpressionAtlasiO00338 baseline and differential
GenevisibleiO00338 HS

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR000863 Sulfotransferase_dom
PfamiView protein in Pfam
PF00685 Sulfotransfer_1, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiST1C2_HUMAN
AccessioniPrimary (citable) accession number: O00338
Secondary accession number(s): B2R813, Q53SG4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 1, 1997
Last modified: September 12, 2018
This is version 162 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again