Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-4

Gene

CACNB4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium channel activity Source: Reactome
  • high voltage-gated calcium channel activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-112308 Presynaptic depolarization and calcium channel opening
R-HSA-419037 NCAM1 interactions
R-HSA-5576892 Phase 0 - rapid depolarisation
R-HSA-5576893 Phase 2 - plateau phase

Protein family/group databases

Transport Classification Database

More...
TCDBi
8.A.22.1.4 the ca(2+) channel auxiliary subunit Beta types 1-4 (cca-Beta) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-4Curated
Short name:
CAB4Curated
Alternative name(s):
Calcium channel voltage-dependent subunit beta 4Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CACNB4Imported
Synonyms:CACNLB4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000182389.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1404 CACNB4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601949 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O00305

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Epilepsy, idiopathic generalized 9 (EIG9)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by recurring generalized seizures in the absence of detectable brain lesions and/or metabolic abnormalities. Generalized seizures arise diffusely and simultaneously from both hemispheres of the brain.
See also OMIM:607682
Juvenile myoclonic epilepsy 6 (EJM6)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA subtype of idiopathic generalized epilepsy. Patients have afebrile seizures only, with onset in adolescence (rather than in childhood) and myoclonic jerks which usually occur after awakening and are triggered by sleep deprivation and fatigue.
See also OMIM:607682
Episodic ataxia 5 (EA5)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by episodes of vertigo and ataxia that last for several hours. Interictal examination show spontaneous downbeat and gaze-evoked nystagmus, mild dysarthria and truncal ataxia.
See also OMIM:613855
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_013669104C → F in EA5; associated with susceptibility to EIG9. 1 PublicationCorresponds to variant dbSNP:rs1805031EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Epilepsy

Organism-specific databases

DisGeNET

More...
DisGeNETi
785

MalaCards human disease database

More...
MalaCardsi
CACNB4
MIMi607682 phenotype
613855 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000182389

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
211067 Episodic ataxia type 5
307 Juvenile myoclonic epilepsy

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26014

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2363032

Drug and drug target database

More...
DrugBanki
DB04855 Dronedarone
DB01388 Mibefradil
DB00393 Nimodipine
DB00421 Spironolactone
DB00661 Verapamil

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CACNB4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001440601 – 520Voltage-dependent L-type calcium channel subunit beta-4Add BLAST520

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei39PhosphoserineBy similarity1
Modified residuei183PhosphoserineBy similarity1
Modified residuei411PhosphothreonineBy similarity1
Modified residuei448PhosphoserineBy similarity1
Modified residuei506Omega-N-methylarginineBy similarity1
Modified residuei508PhosphoserineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O00305

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O00305

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O00305

PeptideAtlas

More...
PeptideAtlasi
O00305

PRoteomics IDEntifications database

More...
PRIDEi
O00305

ProteomicsDB human proteome resource

More...
ProteomicsDBi
47831
47832 [O00305-2]
47833 [O00305-3]
47834 [O00305-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O00305

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O00305

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed predominantly in the cerebellum and kidney.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000182389 Expressed in 140 organ(s), highest expression level in caudate nucleus

CleanEx database of gene expression profiles

More...
CleanExi
HS_CACNB4

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O00305 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O00305 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA015601

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma (PubMed:11880487). Interacts with FASLG (PubMed:19807924). Interacts with CBARP (By similarity).By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107239, 8 interactors

Protein interaction database and analysis system

More...
IntActi
O00305, 10 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000438949

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1520
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D46NMR-A50-92[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O00305

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O00305

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O00305

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini92 – 161SH3PROSITE-ProRule annotationAdd BLAST70

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3812 Eukaryota
ENOG410XRDI LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153663

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230979

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050765

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O00305

KEGG Orthology (KO)

More...
KOi
K04865

Identification of Orthologs from Complete Genome Data

More...
OMAi
SYQDSYK

Database of Orthologous Groups

More...
OrthoDBi
926074at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O00305

TreeFam database of animal gene trees

More...
TreeFami
TF316195

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR027417 P-loop_NTPase
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR000584 VDCC_L_bsu

The PANTHER Classification System

More...
PANTHERi
PTHR11824 PTHR11824, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF12052 VGCC_beta4Aa_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01626 LCACHANNELB

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072 GuKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 46 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O00305-1) [UniParc]FASTAAdd to basket
Also known as: 4b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSSSYAKNG TADGPHSPTS QVARGTTTRR SRLKRSDGST TSTSFILRQG
60 70 80 90 100
SADSYTSRPS DSDVSLEEDR EAIRQEREQQ AAIQLERAKS KPVAFAVKTN
110 120 130 140 150
VSYCGALDED VPVPSTAISF DAKDFLHIKE KYNNDWWIGR LVKEGCEIGF
160 170 180 190 200
IPSPLRLENI RIQQEQKRGR FHGGKSSGNS SSSLGEMVSG TFRATPTSTA
210 220 230 240 250
KQKQKVTEHI PPYDVVPSMR PVVLVGPSLK GYEVTDMMQK ALFDFLKHRF
260 270 280 290 300
DGRISITRVT ADISLAKRSV LNNPSKRAII ERSNTRSSLA EVQSEIERIF
310 320 330 340 350
ELARSLQLVV LDADTINHPA QLIKTSLAPI IVHVKVSSPK VLQRLIKSRG
360 370 380 390 400
KSQSKHLNVQ LVAADKLAQC PPEMFDVILD ENQLEDACEH LGEYLEAYWR
410 420 430 440 450
ATHTTSSTPM TPLLGRNLGS TALSPYPTAI SGLQSQRMRH SNHSTENSPI
460 470 480 490 500
ERRSLMTSDE NYHNERARKS RNRLSSSSQH SRDHYPLVEE DYPDSYQDTY
510 520
KPHRNRGSPG GYSHDSRHRL
Length:520
Mass (Da):58,169
Last modified:February 6, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i21025FA9782347FA
GO
Isoform 2 (identifier: O00305-2) [UniParc]FASTAAdd to basket
Also known as: 4a

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQ → MYDNLYLHGIEDSEA

Show »
Length:486
Mass (Da):54,707
Checksum:i5E8F03EA98A88597
GO
Isoform 3 (identifier: O00305-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MSSSSYAKNGTADGPHSPTSQ → MDV

Note: No experimental confirmation available.
Show »
Length:502
Mass (Da):56,422
Checksum:i24BA6BA3A89A46BB
GO
Isoform 4 (identifier: O00305-4) [UniParc]FASTAAdd to basket
Also known as: 4d

The sequence of this isoform differs from the canonical sequence as follows:
     373-434: Missing.

Note: Unable to interact with the alpha-1 subunit.
Show »
Length:458
Mass (Da):51,331
Checksum:i4AC560044A3BA110
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 46 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y476H0Y476_HUMAN
Voltage-dependent L-type calcium ch...
CACNB4
473Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7DBM8E7DBM8_HUMAN
Voltage-dependent L-type calcium ch...
CACNB4
207Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EN11E7EN11_HUMAN
Voltage-dependent L-type calcium ch...
CACNB4
441Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GTK1A0A1B0GTK1_HUMAN
Voltage-dependent L-type calcium ch...
CACNB4
423Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GTX8A0A1B0GTX8_HUMAN
Voltage-dependent L-type calcium ch...
CACNB4
410Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J224C9J224_HUMAN
Voltage-dependent L-type calcium ch...
CACNB4
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GXG0A0A1B0GXG0_HUMAN
Voltage-dependent L-type calcium ch...
CACNB4
472Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GTS4A0A1B0GTS4_HUMAN
Voltage-dependent L-type calcium ch...
CACNB4
411Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GUW8A0A1B0GUW8_HUMAN
Voltage-dependent L-type calcium ch...
CACNB4
215Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GVB2A0A1B0GVB2_HUMAN
Voltage-dependent L-type calcium ch...
CACNB4
393Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti245F → S in AAB53333 (PubMed:9254841).Curated1
Sequence conflicti245F → S in AAL14351 (PubMed:11880487).Curated1
Sequence conflicti311L → V in AAL14351 (PubMed:11880487).Curated1
Sequence conflicti441S → T in AAL14351 (PubMed:11880487).Curated1
Isoform 2 (identifier: O00305-2)
Sequence conflicti12D → N in AAL14351 (PubMed:11880487).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_013669104C → F in EA5; associated with susceptibility to EIG9. 1 PublicationCorresponds to variant dbSNP:rs1805031EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0006351 – 49MSSSS…FILRQ → MYDNLYLHGIEDSEA in isoform 2. 2 PublicationsAdd BLAST49
Alternative sequenceiVSP_0431921 – 21MSSSS…SPTSQ → MDV in isoform 3. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_043193373 – 434Missing in isoform 4. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U95020 mRNA Translation: AAB53333.1
AY054985 mRNA Translation: AAL14351.1
AB302276 mRNA Translation: BAF73808.1
AK290049 mRNA Translation: BAF82738.1
AK294398 mRNA Translation: BAG57651.1
AK316045 mRNA Translation: BAH14416.1
AC068547 Genomic DNA No translation available.
AC079790 Genomic DNA No translation available.
AC097448 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX11494.1
BC075049 mRNA Translation: AAH75049.1
AF038852 mRNA Translation: AAC24206.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46426.1 [O00305-1]
CCDS46427.1 [O00305-3]
CCDS46428.1 [O00305-2]
CCDS54409.1 [O00305-4]

NCBI Reference Sequences

More...
RefSeqi
NP_000717.2, NM_000726.4 [O00305-1]
NP_001005746.1, NM_001005746.3 [O00305-3]
NP_001005747.1, NM_001005747.3 [O00305-2]
NP_001139270.1, NM_001145798.2 [O00305-4]
NP_001307651.1, NM_001320722.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.120725

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000201943; ENSP00000201943; ENSG00000182389 [O00305-4]
ENST00000534999; ENSP00000443893; ENSG00000182389 [O00305-2]
ENST00000539935; ENSP00000438949; ENSG00000182389 [O00305-1]
ENST00000638005; ENSP00000489677; ENSG00000182389 [O00305-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
785

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:785

UCSC genome browser

More...
UCSCi
uc002txy.5 human [O00305-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U95020 mRNA Translation: AAB53333.1
AY054985 mRNA Translation: AAL14351.1
AB302276 mRNA Translation: BAF73808.1
AK290049 mRNA Translation: BAF82738.1
AK294398 mRNA Translation: BAG57651.1
AK316045 mRNA Translation: BAH14416.1
AC068547 Genomic DNA No translation available.
AC079790 Genomic DNA No translation available.
AC097448 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX11494.1
BC075049 mRNA Translation: AAH75049.1
AF038852 mRNA Translation: AAC24206.1
CCDSiCCDS46426.1 [O00305-1]
CCDS46427.1 [O00305-3]
CCDS46428.1 [O00305-2]
CCDS54409.1 [O00305-4]
RefSeqiNP_000717.2, NM_000726.4 [O00305-1]
NP_001005746.1, NM_001005746.3 [O00305-3]
NP_001005747.1, NM_001005747.3 [O00305-2]
NP_001139270.1, NM_001145798.2 [O00305-4]
NP_001307651.1, NM_001320722.2
UniGeneiHs.120725

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D46NMR-A50-92[»]
ProteinModelPortaliO00305
SMRiO00305
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107239, 8 interactors
IntActiO00305, 10 interactors
STRINGi9606.ENSP00000438949

Chemistry databases

ChEMBLiCHEMBL2363032
DrugBankiDB04855 Dronedarone
DB01388 Mibefradil
DB00393 Nimodipine
DB00421 Spironolactone
DB00661 Verapamil

Protein family/group databases

TCDBi8.A.22.1.4 the ca(2+) channel auxiliary subunit Beta types 1-4 (cca-Beta) family

PTM databases

iPTMnetiO00305
PhosphoSitePlusiO00305

Polymorphism and mutation databases

BioMutaiCACNB4

Proteomic databases

jPOSTiO00305
MaxQBiO00305
PaxDbiO00305
PeptideAtlasiO00305
PRIDEiO00305
ProteomicsDBi47831
47832 [O00305-2]
47833 [O00305-3]
47834 [O00305-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000201943; ENSP00000201943; ENSG00000182389 [O00305-4]
ENST00000534999; ENSP00000443893; ENSG00000182389 [O00305-2]
ENST00000539935; ENSP00000438949; ENSG00000182389 [O00305-1]
ENST00000638005; ENSP00000489677; ENSG00000182389 [O00305-3]
GeneIDi785
KEGGihsa:785
UCSCiuc002txy.5 human [O00305-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
785
DisGeNETi785
EuPathDBiHostDB:ENSG00000182389.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CACNB4
HGNCiHGNC:1404 CACNB4
HPAiHPA015601
MalaCardsiCACNB4
MIMi601949 gene
607682 phenotype
613855 phenotype
neXtProtiNX_O00305
OpenTargetsiENSG00000182389
Orphaneti211067 Episodic ataxia type 5
307 Juvenile myoclonic epilepsy
PharmGKBiPA26014

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3812 Eukaryota
ENOG410XRDI LUCA
GeneTreeiENSGT00940000153663
HOGENOMiHOG000230979
HOVERGENiHBG050765
InParanoidiO00305
KOiK04865
OMAiSYQDSYK
OrthoDBi926074at2759
PhylomeDBiO00305
TreeFamiTF316195

Enzyme and pathway databases

ReactomeiR-HSA-112308 Presynaptic depolarization and calcium channel opening
R-HSA-419037 NCAM1 interactions
R-HSA-5576892 Phase 0 - rapid depolarisation
R-HSA-5576893 Phase 2 - plateau phase

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CACNB4 human
EvolutionaryTraceiO00305

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CACNB4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
785

Protein Ontology

More...
PROi
PR:O00305

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000182389 Expressed in 140 organ(s), highest expression level in caudate nucleus
CleanExiHS_CACNB4
ExpressionAtlasiO00305 baseline and differential
GenevisibleiO00305 HS

Family and domain databases

InterProiView protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR027417 P-loop_NTPase
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR000584 VDCC_L_bsu
PANTHERiPTHR11824 PTHR11824, 1 hit
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF12052 VGCC_beta4Aa_N, 1 hit
PRINTSiPR01626 LCACHANNELB
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCACB4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00305
Secondary accession number(s): A7BJ74
, A8K1Y4, B4DG40, O60515, Q6B000, Q96L40
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: February 6, 2007
Last modified: January 16, 2019
This is version 193 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again