PGRMC1

Functionⁱ

Component of a progesterone-binding protein complex (PubMed:28396637). Binds progesterone (PubMed:25675345). Has many reported cellular functions (heme homeostasis, interaction with CYPs).1 Publication1 Publication

Miscellaneous

Non-classical progesterone receptors involved in extranuclear signaling are classified in 2 groups: the class II progestin and adipoQ receptor (PAQR) family (also called mPRs) (PAQR5, PAQR6, PAQR7, PAQR8 and PAQR9) and the b5-like heme/steroid-binding protein family (also called MAPRs) (PGRMC1, PGRMC2, NENF and CYB5D2).2 Publications

Caution

Was initially identified as sigma-2 receptor, which is thought to play important role in regulating cell survival, morphology and differentiation (PubMed:21730960, PubMed:22292588, PubMed:28007569). However, it was later shown that it is not the case (PubMed:28007569). The sigma-2 receptor has been identified as TMEM97 (AC Q5BJF2) (PubMed:28559337).4 Publications

GO - Molecular functionⁱ

amyloid-beta binding
Source: ARUK-UCL
Traceable author statementⁱ
- 26871627
heme binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
steroid binding
Source: ProtInc
Traceable author statementⁱ
- 9705155

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

neutrophil degranulation Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Receptor
Ligand	Lipid-binding, Steroid-binding

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6798695 Neutrophil degranulation

Reactomeⁱ

R-HSA-6798695 Neutrophil degranulation

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Membrane-associated progesterone receptor component 1 Short name: mPR Alternative name(s): Dap11 Publication IZA1 Publication
Gene namesⁱ	Name:PGRMC1Imported Synonyms:HPR6.6, PGRMC
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome X

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000101856.9
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:16090 PGRMC1
MIMⁱ	300435 gene
neXtProtⁱ	NX_O00264

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 24	LumenalSequence analysisAdd BLAST	24
Transmembraneⁱ	25 – 43	HelicalSequence analysisAdd BLAST	19
Topological domainⁱ	44 – 195	CytoplasmicSequence analysisAdd BLAST	152

Keywords - Cellular componentⁱ

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	10857
Open Targets More...OpenTargetsⁱ	ENSG00000101856
Orphanetⁱ	619 NON RARE IN EUROPE: Primary ovarian failure
PharmGKBⁱ	PA33248

Chemistry databases

Drug and drug target database More...DrugBankⁱ	DB00514 Dextromethorphan DB00540 Nortriptyline

DrugBankⁱ

DB00514 Dextromethorphan
DB00540 Nortriptyline

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000121739	1 – 195	Membrane-associated progesterone receptor component 1Add BLAST		195

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	54	PhosphoserineCombined sources	1
Modified residueⁱ	57	PhosphoserineCombined sources	1
Modified residueⁱ	74	PhosphothreonineCombined sources	1
Modified residueⁱ	181	PhosphoserineCombined sources1 Publication	1

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

EPDⁱ	O00264
PaxDbⁱ	O00264
PeptideAtlas More...PeptideAtlasⁱ	O00264
PRIDEⁱ	O00264
ProteomicsDBⁱ	47815
TopDownProteomicsⁱ	O00264-1 [O00264-1]

2D gel databases

USC-OGP 2-DE database More...OGPⁱ	O00264

OGPⁱ

O00264

PTM databases

iPTMnetⁱ	O00264
PhosphoSitePlusⁱ	O00264
SwissPalmⁱ	O00264

Expressionⁱ

Tissue specificityⁱ

Widely expressed, with highest expression in liver and kidney.

Gene expression databases

Bgeeⁱ	ENSG00000101856 Expressed in 238 organ(s), highest expression level in metanephros
CleanExⁱ	HS_PGRMC1
ExpressionAtlasⁱ	O00264 baseline and differential
Genevisibleⁱ	O00264 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA002877

HPAⁱ

HPA002877

Interactionⁱ

Subunit structureⁱ

Homodimer. Forms stable homodimer through hydrophobic heme-heme stacking interactions.1 Publication

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
CYP2C2	P00181	6	EBI-1045534,EBI-4320576	From Oryctolagus cuniculus.
FECH	P22830	3	EBI-1045534,EBI-1390356
POR	P16435	5	EBI-1045534,EBI-726554

Protein-protein interaction databases

BioGridⁱ	116068, 55 interactors
CORUMⁱ	O00264
IntActⁱ	O00264, 68 interactors
Molecular INTeraction database More...MINTⁱ	O00264
STRINGⁱ	9606.ENSP00000217971

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	75 – 78	Combined sources	4
Beta strandⁱ	82 – 87	Combined sources	6
Beta strandⁱ	89 – 93	Combined sources	5
Beta strandⁱ	96 – 99	Combined sources	4
Helixⁱ	101 – 103	Combined sources	3
Helixⁱ	104 – 107	Combined sources	4
Helixⁱ	114 – 116	Combined sources	3
Helixⁱ	122 – 127	Combined sources	6
Helixⁱ	132 – 134	Combined sources	3
Helixⁱ	142 – 144	Combined sources	3
Helixⁱ	147 – 163	Combined sources	17
Beta strandⁱ	164 – 170	Combined sources	7

Show more details

3D structure databases

ProteinModelPortalⁱ	O00264
SMRⁱ	O00264
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	72 – 171	Cytochrome b5 heme-bindingAdd BLAST		100

Domainⁱ

The cytochrome b5 heme-binding domain lacks the conserved iron-binding His residues at positions 107 and 131.By similarity

Sequence similaritiesⁱ

Belongs to the cytochrome b5 family. MAPR subfamily.Curated

Keywords - Domainⁱ

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG1110 Eukaryota ENOG4111UG0 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00730000110959
HOGENOMⁱ	HOG000187840
HOVERGENⁱ	HBG059971
InParanoidⁱ	O00264
KEGG Orthology (KO) More...KOⁱ	K17278
OMAⁱ	LLYKIFR
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0PXT
PhylomeDBⁱ	O00264
TreeFamⁱ	TF314562

Family and domain databases

Gene3Dⁱ	3.10.120.10, 1 hit
InterProⁱ	View protein in InterPro IPR001199 Cyt_B5-like_heme/steroid-bd IPR036400 Cyt_B5-like_heme/steroid_sf
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00173 Cyt-b5, 1 hit
SMARTⁱ	View protein in SMART SM01117 Cyt-b5, 1 hit
SUPFAMⁱ	SSF55856 SSF55856, 1 hit

Sequences (2)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

Isoform 1 (identifier: O00264-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAEDVVATG ADPSDLESGG LLHEIFTSPL NLLLLGLCIF LLYKIVRGDQ 
        60         70         80         90        100
PAASGDSDDD EPPPLPRLKR RDFTPAELRR FDGVQDPRIL MAINGKVFDV 
       110        120        130        140        150
TKGRKFYGPE GPYGVFAGRD ASRGLATFCL DKEALKDEYD DLSDLTAAQQ 
       160        170        180        190 
ETLSDWESQF TFKYHHVGKL LKEGEEPTVY SDEEEPKDES ARKND

Length:195

Mass (Da):21,671

Last modified:January 23, 2007 - v3

Checksum:ⁱCCD5E802E1C9E604

GO

Isoform 2 (identifier: O00264-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
110-162: EGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTF → V

« Hide

        10         20         30         40         50
MAAEDVVATG ADPSDLESGG LLHEIFTSPL NLLLLGLCIF LLYKIVRGDQ 
        60         70         80         90        100
PAASGDSDDD EPPPLPRLKR RDFTPAELRR FDGVQDPRIL MAINGKVFDV 
       110        120        130        140 
TKGRKFYGPV KYHHVGKLLK EGEEPTVYSD EEEPKDESAR KND

Note: No experimental confirmation available.

Show »

Length:143

Mass (Da):15,879

Checksum:ⁱ51538E8883D9E1EC

GO

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_054710	110 – 162	EGPYG…SQFTF → V in isoform 2. 1 PublicationAdd BLAST		53

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	Y12711 mRNA Translation: CAA73248.1 AK293618 mRNA Translation: BAH11549.1 AC004835 Genomic DNA No translation available. CH471161 Genomic DNA Translation: EAW89881.1 BC034238 mRNA Translation: AAH34238.1 AJ249131 Genomic DNA Translation: CAB65109.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS14576.1 [O00264-1] CCDS65313.1 [O00264-2]
NCBI Reference Sequences More...RefSeqⁱ	NP_001269550.1, NM_001282621.1 [O00264-2] NP_006658.1, NM_006667.4 [O00264-1]
UniGeneⁱ	Hs.90061

Genome annotation databases

Ensemblⁱ	ENST00000217971; ENSP00000217971; ENSG00000101856 [O00264-1] ENST00000535419; ENSP00000442821; ENSG00000101856 [O00264-2]
GeneIDⁱ	10857
KEGGⁱ	hsa:10857
UCSC genome browser More...UCSCⁱ	uc011mts.4 human [O00264-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O00264	PGRMC1 protein		HUMAN		195	UniRef100_O00264
PGRMC1 isoform 2		PANTR		195
Uncharacterized protein		PANPA		195
O00264-2	PGRMC1 isoform 1		PANTR		143	UniRef100_H2QZ17
Uncharacterized protein		PANPA		143

Protein	Similar proteins		Species	Score	Length	Source
O00264	Membrane-associated progesterone receptor component 1		RAT		195	UniRef90_P70580
Membrane-associated progesterone receptor component 1		PONAB		195
Membrane-associated progesterone receptor component 1		MOUSE		195
Membrane-associated progesterone receptor component 1		BOVIN		194
Uncharacterized protein (Fragment)		AILME		200
+81
O00264-2	PGRMC1 isoform 1		PANTR		143	UniRef90_H2QZ17
Uncharacterized protein		PANPA		143
Uncharacterized protein		PROCO		143
Progesterone receptor membrane component 1		CALJA		143
Progesterone receptor membrane component 1		SAIBB		143
+28

Protein	Similar proteins		Species	Score	Length	Source
O00264	Membrane-associated progesterone receptor component 1		RAT		195	UniRef50_P70580
Membrane-associated progesterone receptor component 1		PONAB		195
Membrane-associated progesterone receptor component 1		MOUSE		195
Membrane-associated progesterone receptor component 1		BOVIN		194
Membrane-associated progesterone receptor component 1		CHICK		192
+219
O00264-2	PGRMC1 isoform 1		PANTR		143	UniRef50_H2QZ17
Uncharacterized protein		PANPA		143
Uncharacterized protein		PAPAN		143
Uncharacterized protein		MACMU		143
Uncharacterized protein		MACFA		143
+37

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	Y12711 mRNA Translation: CAA73248.1 AK293618 mRNA Translation: BAH11549.1 AC004835 Genomic DNA No translation available. CH471161 Genomic DNA Translation: EAW89881.1 BC034238 mRNA Translation: AAH34238.1 AJ249131 Genomic DNA Translation: CAB65109.1
CCDSⁱ	CCDS14576.1 [O00264-1] CCDS65313.1 [O00264-2]
RefSeqⁱ	NP_001269550.1, NM_001282621.1 [O00264-2] NP_006658.1, NM_006667.4 [O00264-1]
UniGeneⁱ	Hs.90061

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	4X8Y	X-ray	1.95	A/B	72-195	[»]
ProteinModelPortalⁱ	O00264
SMRⁱ	O00264
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	116068, 55 interactors
CORUMⁱ	O00264
IntActⁱ	O00264, 68 interactors
MINTⁱ	O00264
STRINGⁱ	9606.ENSP00000217971

Chemistry databases

DrugBankⁱ	DB00514 Dextromethorphan DB00540 Nortriptyline

DrugBankⁱ

DB00514 Dextromethorphan
DB00540 Nortriptyline

PTM databases

iPTMnetⁱ	O00264
PhosphoSitePlusⁱ	O00264
SwissPalmⁱ	O00264

2D gel databases

OGPⁱ	O00264

OGPⁱ

O00264

Proteomic databases

EPDⁱ	O00264
PaxDbⁱ	O00264
PeptideAtlasⁱ	O00264
PRIDEⁱ	O00264
ProteomicsDBⁱ	47815
TopDownProteomicsⁱ	O00264-1 [O00264-1]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	10857
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000217971; ENSP00000217971; ENSG00000101856 [O00264-1] ENST00000535419; ENSP00000442821; ENSG00000101856 [O00264-2]
GeneIDⁱ	10857
KEGGⁱ	hsa:10857
UCSCⁱ	uc011mts.4 human [O00264-1]

Organism-specific databases

CTDⁱ	10857
DisGeNETⁱ	10857
EuPathDBⁱ	HostDB:ENSG00000101856.9
GeneCardsⁱ	PGRMC1
HGNCⁱ	HGNC:16090 PGRMC1
HPAⁱ	HPA002877
MIMⁱ	300435 gene
neXtProtⁱ	NX_O00264
OpenTargetsⁱ	ENSG00000101856
Orphanetⁱ	619 NON RARE IN EUROPE: Primary ovarian failure
PharmGKBⁱ	PA33248
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1110 Eukaryota ENOG4111UG0 LUCA
GeneTreeⁱ	ENSGT00730000110959
HOGENOMⁱ	HOG000187840
HOVERGENⁱ	HBG059971
InParanoidⁱ	O00264
KOⁱ	K17278
OMAⁱ	LLYKIFR
OrthoDBⁱ	EOG091G0PXT
PhylomeDBⁱ	O00264
TreeFamⁱ	TF314562

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6798695 Neutrophil degranulation

Reactomeⁱ

R-HSA-6798695 Neutrophil degranulation

Miscellaneous databases

ChiTaRSⁱ	PGRMC1 human
GeneWikiⁱ	PGRMC1
GenomeRNAiⁱ	10857
Protein Ontology More...PROⁱ	PR:O00264
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000101856 Expressed in 238 organ(s), highest expression level in metanephros
CleanExⁱ	HS_PGRMC1
ExpressionAtlasⁱ	O00264 baseline and differential
Genevisibleⁱ	O00264 HS

Family and domain databases

Gene3Dⁱ	3.10.120.10, 1 hit
InterProⁱ	View protein in InterPro IPR001199 Cyt_B5-like_heme/steroid-bd IPR036400 Cyt_B5-like_heme/steroid_sf
Pfamⁱ	View protein in Pfam PF00173 Cyt-b5, 1 hit
SMARTⁱ	View protein in SMART SM01117 Cyt-b5, 1 hit
SUPFAMⁱ	SSF55856 SSF55856, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	PGRC1_HUMAN
Accessionⁱ	O00264Primary (citable) accession number: O00264 Secondary accession number(s): B7Z1L3, Q9UGJ9
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 30, 2000
	Last sequence update:	January 23, 2007
	Last modified:	November 7, 2018
	This is version 174 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human chromosome X
Human chromosome X: entries, gene names and cross-references to MIM
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O00264 (PGRC1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Membrane-associated progesterone receptor component 1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

Caution

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Endoplasmic reticulum

Endoplasmic reticulum

Plasma Membrane

Other locations

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

2D gel databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

2D gel databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ