Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hyaluronan synthase 3

Gene

HAS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction (By similarity).By similarity

Catalytic activityi

UDP-alpha-N-acetyl-D-glucosamine + beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-(nascent hyaluronan) = UDP + N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-(nascent hyaluronan).
UDP-alpha-D-glucuronate + N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-(nascent hyaluronan) = UDP + beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-(nascent hyaluronan).

Cofactori

Pathwayi: hyaluronan biosynthesis

This protein is involved in the pathway hyaluronan biosynthesis, which is part of Glycan biosynthesis.
View all proteins of this organism that are known to be involved in the pathway hyaluronan biosynthesis and in Glycan biosynthesis.

GO - Molecular functioni

  • hyaluronan synthase activity Source: UniProtKB
  • identical protein binding Source: IntAct

GO - Biological processi

Keywordsi

Molecular functionGlycosyltransferase, Transferase

Enzyme and pathway databases

BRENDAi2.4.1.212 2681
ReactomeiR-HSA-2142850 Hyaluronan biosynthesis and export
UniPathwayi
UPA00341

Protein family/group databases

CAZyiGT2 Glycosyltransferase Family 2

Names & Taxonomyi

Protein namesi
Recommended name:
Hyaluronan synthase 3 (EC:2.4.1.212)
Alternative name(s):
Hyaluronate synthase 3
Hyaluronic acid synthase 3
Short name:
HA synthase 3
Gene namesi
Name:HAS3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000103044.10
HGNCiHGNC:4820 HAS3
MIMi602428 gene
neXtProtiNX_O00219

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 15CytoplasmicSequence analysisAdd BLAST15
Transmembranei16 – 36Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini37 – 44ExtracellularSequence analysis8
Transmembranei45 – 65Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini66 – 377CytoplasmicSequence analysisAdd BLAST312
Transmembranei378 – 398Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini399 – 408ExtracellularSequence analysis10
Transmembranei409 – 429Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini430 – 440CytoplasmicSequence analysisAdd BLAST11
Transmembranei441 – 461Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini462 – 473ExtracellularSequence analysisAdd BLAST12
Transmembranei474 – 494Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini495 – 515CytoplasmicSequence analysisAdd BLAST21
Transmembranei516 – 536Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini537 – 553ExtracellularSequence analysisAdd BLAST17

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi3038
OpenTargetsiENSG00000103044
PharmGKBiPA29196

Polymorphism and mutation databases

BioMutaiHAS3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001971781 – 553Hyaluronan synthase 3Add BLAST553

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi462N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiO00219
MaxQBiO00219
PaxDbiO00219
PeptideAtlasiO00219
PRIDEiO00219
ProteomicsDBi47788
47789 [O00219-2]

PTM databases

iPTMnetiO00219
PhosphoSitePlusiO00219

Expressioni

Gene expression databases

BgeeiENSG00000103044 Expressed in 150 organ(s), highest expression level in secondary oocyte
CleanExiHS_HAS3
ExpressionAtlasiO00219 baseline and differential
GenevisibleiO00219 HS

Organism-specific databases

HPAiCAB033850
HPA031554

Interactioni

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi109288, 2 interactors
IntActiO00219, 4 interactors
STRINGi9606.ENSP00000304440

Structurei

3D structure databases

ProteinModelPortaliO00219
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the NodC/HAS family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2571 Eukaryota
COG1215 LUCA
GeneTreeiENSGT00390000010337
HOGENOMiHOG000112847
HOVERGENiHBG000189
InParanoidiO00219
KOiK00752
OMAiPTRYLRW
OrthoDBiEOG091G04P3
PhylomeDBiO00219
TreeFamiTF332506

Family and domain databases

InterProiView protein in InterPro
IPR026108 HA_synthase_3
IPR029044 Nucleotide-diphossugar_trans
PANTHERiPTHR22913:SF6 PTHR22913:SF6, 1 hit
SUPFAMiSSF53448 SSF53448, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O00219-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVQLTTALR VVGTSLFALA VLGGILAAYV TGYQFIHTEK HYLSFGLYGA
60 70 80 90 100
ILGLHLLIQS LFAFLEHRRM RRAGQALKLP SPRRGSVALC IAAYQEDPDY
110 120 130 140 150
LRKCLRSAQR ISFPDLKVVM VVDGNRQEDA YMLDIFHEVL GGTEQAGFFV
160 170 180 190 200
WRSNFHEAGE GETEASLQEG MDRVRDVVRA STFSCIMQKW GGKREVMYTA
210 220 230 240 250
FKALGDSVDY IQVCDSDTVL DPACTIEMLR VLEEDPQVGG VGGDVQILNK
260 270 280 290 300
YDSWISFLSS VRYWMAFNVE RACQSYFGCV QCISGPLGMY RNSLLQQFLE
310 320 330 340 350
DWYHQKFLGS KCSFGDDRHL TNRVLSLGYR TKYTARSKCL TETPTKYLRW
360 370 380 390 400
LNQQTRWSKS YFREWLYNSL WFHKHHLWMT YESVVTGFFP FFLIATVIQL
410 420 430 440 450
FYRGRIWNIL LFLLTVQLVG IIKATYACFL RGNAEMIFMS LYSLLYMSSL
460 470 480 490 500
LPAKIFAIAT INKSGWGTSG RKTIVVNFIG LIPVSIWVAV LLGGLAYTAY
510 520 530 540 550
CQDLFSETEL AFLVSGAILY GCYWVALLML YLAIIARRCG KKPEQYSLAF

AEV
Length:553
Mass (Da):62,998
Last modified:September 23, 2008 - v3
Checksum:i82F3B0C932EE9EA3
GO
Isoform 2 (identifier: O00219-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-553: ILNKYDSWIS...EQYSLAFAEV → PPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):31,200
Checksum:iBD9AA4E19847764B
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BRH5H3BRH5_HUMAN
Hyaluronan synthase 3
HAS3
264Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti493G → E in AAF36984 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049317173R → H. Corresponds to variant dbSNP:rs2232229Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042022247 – 553ILNKY…AFAEV → PPGKGMAVEDDQVQAAQVRA TEAWSVHQRHVSREQ in isoform 2. 1 PublicationAdd BLAST307

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF232772 mRNA Translation: AAF36984.1
AK291400 mRNA Translation: BAF84089.1
AC009027 Genomic DNA No translation available.
CH471092 Genomic DNA Translation: EAW83247.1
CH471092 Genomic DNA Translation: EAW83248.1
BC021853 mRNA Translation: AAH21853.1
U86409 Genomic DNA Translation: AAC51209.1
CCDSiCCDS10870.1 [O00219-2]
CCDS10871.1 [O00219-1]
RefSeqiNP_001186209.1, NM_001199280.1 [O00219-1]
NP_005320.2, NM_005329.2 [O00219-1]
NP_619515.1, NM_138612.2 [O00219-2]
XP_005255978.1, XM_005255921.2 [O00219-1]
XP_011521363.1, XM_011523061.2 [O00219-1]
UniGeneiHs.592069

Genome annotation databases

EnsembliENST00000219322; ENSP00000219322; ENSG00000103044 [O00219-2]
ENST00000306560; ENSP00000304440; ENSG00000103044 [O00219-1]
ENST00000569188; ENSP00000454731; ENSG00000103044 [O00219-1]
GeneIDi3038
KEGGihsa:3038
UCSCiuc002ewk.4 human [O00219-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF232772 mRNA Translation: AAF36984.1
AK291400 mRNA Translation: BAF84089.1
AC009027 Genomic DNA No translation available.
CH471092 Genomic DNA Translation: EAW83247.1
CH471092 Genomic DNA Translation: EAW83248.1
BC021853 mRNA Translation: AAH21853.1
U86409 Genomic DNA Translation: AAC51209.1
CCDSiCCDS10870.1 [O00219-2]
CCDS10871.1 [O00219-1]
RefSeqiNP_001186209.1, NM_001199280.1 [O00219-1]
NP_005320.2, NM_005329.2 [O00219-1]
NP_619515.1, NM_138612.2 [O00219-2]
XP_005255978.1, XM_005255921.2 [O00219-1]
XP_011521363.1, XM_011523061.2 [O00219-1]
UniGeneiHs.592069

3D structure databases

ProteinModelPortaliO00219
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109288, 2 interactors
IntActiO00219, 4 interactors
STRINGi9606.ENSP00000304440

Protein family/group databases

CAZyiGT2 Glycosyltransferase Family 2

PTM databases

iPTMnetiO00219
PhosphoSitePlusiO00219

Polymorphism and mutation databases

BioMutaiHAS3

Proteomic databases

EPDiO00219
MaxQBiO00219
PaxDbiO00219
PeptideAtlasiO00219
PRIDEiO00219
ProteomicsDBi47788
47789 [O00219-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000219322; ENSP00000219322; ENSG00000103044 [O00219-2]
ENST00000306560; ENSP00000304440; ENSG00000103044 [O00219-1]
ENST00000569188; ENSP00000454731; ENSG00000103044 [O00219-1]
GeneIDi3038
KEGGihsa:3038
UCSCiuc002ewk.4 human [O00219-1]

Organism-specific databases

CTDi3038
DisGeNETi3038
EuPathDBiHostDB:ENSG00000103044.10
GeneCardsiHAS3
HGNCiHGNC:4820 HAS3
HPAiCAB033850
HPA031554
MIMi602428 gene
neXtProtiNX_O00219
OpenTargetsiENSG00000103044
PharmGKBiPA29196
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2571 Eukaryota
COG1215 LUCA
GeneTreeiENSGT00390000010337
HOGENOMiHOG000112847
HOVERGENiHBG000189
InParanoidiO00219
KOiK00752
OMAiPTRYLRW
OrthoDBiEOG091G04P3
PhylomeDBiO00219
TreeFamiTF332506

Enzyme and pathway databases

UniPathwayi
UPA00341

BRENDAi2.4.1.212 2681
ReactomeiR-HSA-2142850 Hyaluronan biosynthesis and export

Miscellaneous databases

GeneWikiiHAS3
GenomeRNAii3038
PROiPR:O00219
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000103044 Expressed in 150 organ(s), highest expression level in secondary oocyte
CleanExiHS_HAS3
ExpressionAtlasiO00219 baseline and differential
GenevisibleiO00219 HS

Family and domain databases

InterProiView protein in InterPro
IPR026108 HA_synthase_3
IPR029044 Nucleotide-diphossugar_trans
PANTHERiPTHR22913:SF6 PTHR22913:SF6, 1 hit
SUPFAMiSSF53448 SSF53448, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiHYAS3_HUMAN
AccessioniPrimary (citable) accession number: O00219
Secondary accession number(s): A8K5T5, Q8WTZ0, Q9NYP0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: September 23, 2008
Last modified: November 7, 2018
This is version 159 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again