Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - O00219 (HYAS3_HUMAN)

Entry version 175 (07 Apr 2021)
Sequence version 3 (23 Sep 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Hyaluronan synthase 3

Gene

HAS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: hyaluronan biosynthesis

This protein is involved in the pathway hyaluronan biosynthesis, which is part of Glycan biosynthesis.
View all proteins of this organism that are known to be involved in the pathway hyaluronan biosynthesis and in Glycan biosynthesis.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosyltransferase, Transferase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.4.1.212, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O00219

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-2142850, Hyaluronan biosynthesis and export

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00341

Protein family/group databases

Carbohydrate-Active enZymes

More...CAZyi		GT2, Glycosyltransferase Family 2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Hyaluronan synthase 3 (EC:2.4.1.212)
Alternative name(s):
Hyaluronate synthase 3
Hyaluronic acid synthase 3
Short name:
HA synthase 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HAS3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:4820, HAS3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602428, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O00219

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000103044.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 15CytoplasmicSequence analysisAdd BLAST15
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei16 – 36Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini37 – 44ExtracellularSequence analysis8
Transmembranei45 – 65Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini66 – 377CytoplasmicSequence analysisAdd BLAST312
Transmembranei378 – 398Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini399 – 408ExtracellularSequence analysis10
Transmembranei409 – 429Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini430 – 440CytoplasmicSequence analysisAdd BLAST11
Transmembranei441 – 461Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini462 – 473ExtracellularSequence analysisAdd BLAST12
Transmembranei474 – 494Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini495 – 515CytoplasmicSequence analysisAdd BLAST21
Transmembranei516 – 536Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini537 – 553ExtracellularSequence analysisAdd BLAST17

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		3038

Open Targets

More...OpenTargetsi		ENSG00000103044

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA29196

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O00219, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		HAS3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001971781 – 553Hyaluronan synthase 3Add BLAST553

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi462N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O00219

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O00219

MaxQB - The MaxQuant DataBase

More...MaxQBi		O00219

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O00219

PeptideAtlas

More...PeptideAtlasi		O00219

PRoteomics IDEntifications database

More...PRIDEi		O00219

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		47788 [O00219-1]
47789 [O00219-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O00219, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O00219

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O00219

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000103044, Expressed in secondary oocyte and 170 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O00219, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O00219, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000103044, Tissue enhanced (esophagus, urinary bladder)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		109288, 8 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O00219

Protein interaction database and analysis system

More...IntActi		O00219, 9 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000304440

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O00219, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NodC/HAS family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2571, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000010337

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_029695_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O00219

Identification of Orthologs from Complete Genome Data

More...OMAi		RWARATH

Database for complete collections of gene phylogenies

More...PhylomeDBi		O00219

TreeFam database of animal gene trees

More...TreeFami		TF332506

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029044, Nucleotide-diphossugar_trans

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53448, SSF53448, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O00219-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVQLTTALR VVGTSLFALA VLGGILAAYV TGYQFIHTEK HYLSFGLYGA 
        60         70         80         90        100
ILGLHLLIQS LFAFLEHRRM RRAGQALKLP SPRRGSVALC IAAYQEDPDY 
       110        120        130        140        150
LRKCLRSAQR ISFPDLKVVM VVDGNRQEDA YMLDIFHEVL GGTEQAGFFV 
       160        170        180        190        200
WRSNFHEAGE GETEASLQEG MDRVRDVVRA STFSCIMQKW GGKREVMYTA 
       210        220        230        240        250
FKALGDSVDY IQVCDSDTVL DPACTIEMLR VLEEDPQVGG VGGDVQILNK 
       260        270        280        290        300
YDSWISFLSS VRYWMAFNVE RACQSYFGCV QCISGPLGMY RNSLLQQFLE 
       310        320        330        340        350
DWYHQKFLGS KCSFGDDRHL TNRVLSLGYR TKYTARSKCL TETPTKYLRW 
       360        370        380        390        400
LNQQTRWSKS YFREWLYNSL WFHKHHLWMT YESVVTGFFP FFLIATVIQL 
       410        420        430        440        450
FYRGRIWNIL LFLLTVQLVG IIKATYACFL RGNAEMIFMS LYSLLYMSSL 
       460        470        480        490        500
LPAKIFAIAT INKSGWGTSG RKTIVVNFIG LIPVSIWVAV LLGGLAYTAY 
       510        520        530        540        550
CQDLFSETEL AFLVSGAILY GCYWVALLML YLAIIARRCG KKPEQYSLAF 

AEV
Length:553
Mass (Da):62,998
Last modified:September 23, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i82F3B0C932EE9EA3
GO
Isoform 2 (identifier: O00219-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-553: ILNKYDSWIS...EQYSLAFAEV → PPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ

Show »
Length:281
Mass (Da):31,200
Checksum:iBD9AA4E19847764B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BRH5H3BRH5_HUMAN
Hyaluronan synthase 3
HAS3
264Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti493G → E in AAF36984 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049317173R → H. Corresponds to variant dbSNP:rs2232229Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042022247 – 553ILNKY…AFAEV → PPGKGMAVEDDQVQAAQVRA TEAWSVHQRHVSREQ in isoform 2. 1 PublicationAdd BLAST307

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF232772 mRNA Translation: AAF36984.1
AK291400 mRNA Translation: BAF84089.1
AC009027 Genomic DNA No translation available.
CH471092 Genomic DNA Translation: EAW83247.1
CH471092 Genomic DNA Translation: EAW83248.1
BC021853 mRNA Translation: AAH21853.1
U86409 Genomic DNA Translation: AAC51209.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10870.1 [O00219-2]
CCDS10871.1 [O00219-1]

NCBI Reference Sequences

More...RefSeqi		NP_001186209.1, NM_001199280.1 [O00219-1]
NP_005320.2, NM_005329.2 [O00219-1]
NP_619515.1, NM_138612.2 [O00219-2]
XP_005255978.1, XM_005255921.2 [O00219-1]
XP_011521363.1, XM_011523061.2 [O00219-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000219322; ENSP00000219322; ENSG00000103044 [O00219-2]
ENST00000306560; ENSP00000304440; ENSG00000103044 [O00219-1]
ENST00000569188; ENSP00000454731; ENSG00000103044 [O00219-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3038

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3038

UCSC genome browser

More...UCSCi		uc002ewk.4, human [O00219-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF232772 mRNA Translation: AAF36984.1
AK291400 mRNA Translation: BAF84089.1
AC009027 Genomic DNA No translation available.
CH471092 Genomic DNA Translation: EAW83247.1
CH471092 Genomic DNA Translation: EAW83248.1
BC021853 mRNA Translation: AAH21853.1
U86409 Genomic DNA Translation: AAC51209.1
CCDSiCCDS10870.1 [O00219-2]
CCDS10871.1 [O00219-1]
RefSeqiNP_001186209.1, NM_001199280.1 [O00219-1]
NP_005320.2, NM_005329.2 [O00219-1]
NP_619515.1, NM_138612.2 [O00219-2]
XP_005255978.1, XM_005255921.2 [O00219-1]
XP_011521363.1, XM_011523061.2 [O00219-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi109288, 8 interactors
CORUMiO00219
IntActiO00219, 9 interactors
STRINGi9606.ENSP00000304440

Protein family/group databases

CAZyiGT2, Glycosyltransferase Family 2

PTM databases

GlyGeniO00219, 1 site
iPTMnetiO00219
PhosphoSitePlusiO00219

Genetic variation databases

BioMutaiHAS3

Proteomic databases

EPDiO00219
MassIVEiO00219
MaxQBiO00219
PaxDbiO00219
PeptideAtlasiO00219
PRIDEiO00219
ProteomicsDBi47788 [O00219-1]
47789 [O00219-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		29818, 260 antibodies

Genome annotation databases

EnsembliENST00000219322; ENSP00000219322; ENSG00000103044 [O00219-2]
ENST00000306560; ENSP00000304440; ENSG00000103044 [O00219-1]
ENST00000569188; ENSP00000454731; ENSG00000103044 [O00219-1]
GeneIDi3038
KEGGihsa:3038
UCSCiuc002ewk.4, human [O00219-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3038
DisGeNETi3038

GeneCards: human genes, protein and diseases

More...GeneCardsi		HAS3
HGNCiHGNC:4820, HAS3
HPAiENSG00000103044, Tissue enhanced (esophagus, urinary bladder)
MIMi602428, gene
neXtProtiNX_O00219
OpenTargetsiENSG00000103044
PharmGKBiPA29196
VEuPathDBiHostDB:ENSG00000103044.10

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2571, Eukaryota
GeneTreeiENSGT00390000010337
HOGENOMiCLU_029695_3_0_1
InParanoidiO00219
OMAiRWARATH
PhylomeDBiO00219
TreeFamiTF332506

Enzyme and pathway databases

UniPathwayiUPA00341
BRENDAi2.4.1.212, 2681
PathwayCommonsiO00219
ReactomeiR-HSA-2142850, Hyaluronan biosynthesis and export

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		3038, 6 hits in 986 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		HAS3, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		HAS3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3038
PharosiO00219, Tbio

Protein Ontology

More...PROi		PR:O00219
RNActiO00219, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000103044, Expressed in secondary oocyte and 170 other tissues
ExpressionAtlasiO00219, baseline and differential
GenevisibleiO00219, HS

Family and domain databases

InterProiView protein in InterPro
IPR029044, Nucleotide-diphossugar_trans
SUPFAMiSSF53448, SSF53448, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHYAS3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00219
Secondary accession number(s): A8K5T5, Q8WTZ0, Q9NYP0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: September 23, 2008
Last modified: April 7, 2021
This is version 175 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again