Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Galectin-8

Gene

LGALS8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy (PubMed:22246324, PubMed:28077878). Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture (PubMed:22246324, PubMed:28077878). Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52 (PubMed:22246324, PubMed:28077878). Required to restrict infection of bacterial invasion such as S.typhimurium (PubMed:22246324). Also required to restrict infection of Picornaviridae viruses (PubMed:28077878). Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans (PubMed:21288902).3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei59Critical for binding to sialylated and sulfated oligosaccharides1 Publication1
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei69Carbohydrate1 Publication1
Binding sitei79Carbohydrate1 Publication1
Binding sitei89Carbohydrate1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • carbohydrate binding Source: GO_Central
  • integrin binding Source: UniProtKB

GO - Biological processi

  • cellular response to virus Source: UniProtKB
  • lymphatic endothelial cell migration Source: UniProtKB
  • xenophagy Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAutophagy
LigandLectin

Protein family/group databases

UniLectin database of carbohydrate-binding proteins

More...
UniLectini
O00214

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Galectin-81 Publication
Short name:
Gal-8
Alternative name(s):
Po66 carbohydrate-binding protein
Short name:
Po66-CBP
Prostate carcinoma tumor antigen 11 Publication
Short name:
PCTA-11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LGALS8Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000116977.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6569 LGALS8

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606099 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O00214

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi69R → H: Abolishes localization to cytoplasmic vesicles in case of infection by S.typhimurium. 1 Publication1
Mutagenesisi190R → H: Does not affect localization to cytoplasmic vesicles in case of infection by S.typhimurium. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
3964

Open Targets

More...
OpenTargetsi
ENSG00000116977

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30346

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5475

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LGALS8

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000769431 – 317Galectin-8Add BLAST317

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O00214

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O00214

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O00214

PeptideAtlas

More...
PeptideAtlasi
O00214

PRoteomics IDEntifications database

More...
PRIDEi
O00214

ProteomicsDB human proteome resource

More...
ProteomicsDBi
47785
47786 [O00214-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O00214

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O00214

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000116977 Expressed in 225 organ(s), highest expression level in sperm

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O00214 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O00214 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA012734
HPA030491

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (PubMed:21288902, Ref. 15). Interacts with CALCOCO2/NDP52 (PubMed:22246324). Interacts with PDPN; the interaction is glycosylation-dependent; may participate to connection of the lymphatic endothelium to the surrounding extracellular matrix.3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110155, 114 interactors

Protein interaction database and analysis system

More...
IntActi
O00214, 11 interactors

Molecular INTeraction database

More...
MINTi
O00214

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O00214

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1317
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YRONMR-A176-317[»]
2YV8X-ray1.92A1-152[»]
2YXSX-ray2.13A1-152[»]
3AP4X-ray2.33A/B/C/D1-154[»]
3AP5X-ray1.92A1-154[»]
3AP6X-ray1.58A/B/C/D1-154[»]
3AP7X-ray1.53A1-154[»]
3AP9X-ray1.33A1-154[»]
3APBX-ray1.95A/B1-154[»]
3OJBX-ray3.01A/B/C/D186-315[»]
3VKLX-ray2.55A/B1-155[»]
A/B184-317[»]
3VKMX-ray2.98A/B1-155[»]
A/B184-317[»]
3VKNX-ray1.98A/B1-153[»]
3VKOX-ray2.08A/B1-153[»]
4BMBX-ray1.35A4-153[»]
4BMEX-ray2.00A/B4-155[»]
4FQZX-ray2.80A1-155[»]
A184-317[»]
4GXLX-ray2.02A186-317[»]
4HANX-ray2.55A/B1-155[»]
A/B184-317[»]
5GZCX-ray1.08A7-158[»]
5GZDX-ray1.19A7-154[»]
5GZEX-ray1.32A7-154[»]
5GZFX-ray2.00A1-186[»]
5GZGX-ray2.00A1-186[»]
5T7IX-ray2.00A1-155[»]
5T7SX-ray1.90A1-155[»]
5T7TX-ray1.96A1-155[»]
5T7UX-ray1.58A1-155[»]
5VWGX-ray2.10A1-155[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O00214

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O00214

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O00214

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini19 – 152Galectin 1PROSITE-ProRule annotationAdd BLAST134
Domaini187 – 317Galectin 2PROSITE-ProRule annotationAdd BLAST131

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni249 – 255Beta-galactoside bindingBy similarity7

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Contains two homologous but distinct carbohydrate-binding domains.

Keywords - Domaini

Repeat

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155727

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG002412

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O00214

KEGG Orthology (KO)

More...
KOi
K06832

Identification of Orthologs from Complete Genome Data

More...
OMAi
HASDYFK

Database of Orthologous Groups

More...
OrthoDBi
829777at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O00214

TreeFam database of animal gene trees

More...
TreeFami
TF315551

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00070 GLECT, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320 ConA-like_dom_sf
IPR030638 Galectin_8
IPR001079 Galectin_CRD

The PANTHER Classification System

More...
PANTHERi
PTHR11346:SF22 PTHR11346:SF22, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00337 Gal-bind_lectin, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00908 Gal-bind_lectin, 2 hits
SM00276 GLECT, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51304 GALECTIN, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O00214-1) [UniParc]FASTAAdd to basket
Also known as: I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMLSLNNLQN IIYNPVIPFV GTIPDQLDPG TLIVIRGHVP SDADRFQVDL
60 70 80 90 100
QNGSSMKPRA DVAFHFNPRF KRAGCIVCNT LINEKWGREE ITYDTPFKRE
110 120 130 140 150
KSFEIVIMVL KDKFQVAVNG KHTLLYGHRI GPEKIDTLGI YGKVNIHSIG
160 170 180 190 200
FSFSSDLQST QASSLELTEI SRENVPKSGT PQLRLPFAAR LNTPMGPGRT
210 220 230 240 250
VVVKGEVNAN AKSFNVDLLA GKSKDIALHL NPRLNIKAFV RNSFLQESWG
260 270 280 290 300
EEERNITSFP FSPGMYFEMI IYCDVREFKV AVNGVHSLEY KHRFKELSSI
310
DTLEINGDIH LLEVRSW
Length:317
Mass (Da):35,808
Last modified:March 23, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAA13116AC5C0D69A
GO
Isoform 2 (identifier: O00214-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-183: L → LPSNRGGDISKIAPRTVYTKSKDSTVNHTLTCTKIPPMNYVSK

Show »
Length:359
Mass (Da):40,397
Checksum:i39BED76B4115A798
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T3P9Q5T3P9_HUMAN
Galectin
LGALS8
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1ANM0B1ANM0_HUMAN
Galectin
LGALS8
167Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRN3E9PRN3_HUMAN
Galectin
LGALS8
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJ77E9PJ77_HUMAN
Galectin
LGALS8
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BXD8H7BXD8_HUMAN
Galectin
LGALS8
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PN19E9PN19_HUMAN
Galectin
LGALS8
290Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6V2D4F6V2D4_HUMAN
Galectin
LGALS8
300Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PNC2E9PNC2_HUMAN
Galectin-8
LGALS8
53Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPL1E9PPL1_HUMAN
Galectin-8
LGALS8
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPM4E9PPM4_HUMAN
Galectin-8
LGALS8
53Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB51605 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAD45402 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAD45403 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAD45404 differs from that shown. Probable cloning artifact.Curated
The sequence AAD45404 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH15818 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH16486 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti14N → S in AAL77076 (Ref. 8) Curated1
Sequence conflicti98 – 100KRE → QKEK in CAA62904 (Ref. 2) Curated3
Sequence conflicti112D → A in CAA62904 (Ref. 2) Curated1
Sequence conflicti171S → V in AAB51605 (PubMed:8692978).Curated1
Sequence conflicti199R → G in AAL77076 (Ref. 8) Curated1
Sequence conflicti204K → Q in AAB51605 (PubMed:8692978).Curated1
Sequence conflicti225D → H in AAL77076 (Ref. 8) Curated1
Sequence conflicti259F → L in AAK16736 (Ref. 7) Curated1
Isoform 2 (identifier: O00214-2)
Sequence conflicti220M → T in AAL77076 (Ref. 8) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01299019F → Y4 PublicationsCorresponds to variant dbSNP:rs1126407Ensembl.1
Natural variantiVAR_00971036R → C4 PublicationsCorresponds to variant dbSNP:rs1041935Ensembl.1
Natural variantiVAR_01299156M → V5 PublicationsCorresponds to variant dbSNP:rs1041937Ensembl.1
Natural variantiVAR_063506184R → S4 PublicationsCorresponds to variant dbSNP:rs2243525Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_003094183L → LPSNRGGDISKIAPRTVYTK SKDSTVNHTLTCTKIPPMNY VSK in isoform 2. 4 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L78132 mRNA Translation: AAB51605.1 Different initiation.
X91790 mRNA Translation: CAA62904.1
AF074000 mRNA Translation: AAD45402.1 Different initiation.
AF074001 mRNA Translation: AAD45403.1 Different initiation.
AF074002 mRNA Translation: AAD45404.1 Sequence problems.
AF193806, AF193805 Genomic DNA Translation: AAF19370.1
AF342815 mRNA Translation: AAK16735.1
AF342816 mRNA Translation: AAK16736.1
AF468213 mRNA Translation: AAL77076.1
AL359921 Genomic DNA No translation available.
BC015818 mRNA Translation: AAH15818.1 Different initiation.
BC016486 mRNA Translation: AAH16486.2 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1611.1 [O00214-2]
CCDS1612.1 [O00214-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC6147

NCBI Reference Sequences

More...
RefSeqi
NP_006490.3, NM_006499.4 [O00214-2]
NP_963837.1, NM_201543.2 [O00214-1]
NP_963838.1, NM_201544.2 [O00214-1]
NP_963839.1, NM_201545.2 [O00214-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.4082
Hs.708114
Hs.735982

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000341872; ENSP00000342139; ENSG00000116977 [O00214-1]
ENST00000352231; ENSP00000309576; ENSG00000116977 [O00214-2]
ENST00000366584; ENSP00000355543; ENSG00000116977 [O00214-1]
ENST00000450372; ENSP00000408657; ENSG00000116977 [O00214-2]
ENST00000526589; ENSP00000435460; ENSG00000116977 [O00214-2]
ENST00000526634; ENSP00000437040; ENSG00000116977 [O00214-1]
ENST00000527974; ENSP00000431398; ENSG00000116977 [O00214-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3964

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3964

UCSC genome browser

More...
UCSCi
uc001hxw.3 human [O00214-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Galectin-8 C-terminal CRD

Functional Glycomics Gateway - Glycan Binding

Galectin-8 long isoform

Functional Glycomics Gateway - Glycan Binding

Galectin-8 long isoform

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L78132 mRNA Translation: AAB51605.1 Different initiation.
X91790 mRNA Translation: CAA62904.1
AF074000 mRNA Translation: AAD45402.1 Different initiation.
AF074001 mRNA Translation: AAD45403.1 Different initiation.
AF074002 mRNA Translation: AAD45404.1 Sequence problems.
AF193806, AF193805 Genomic DNA Translation: AAF19370.1
AF342815 mRNA Translation: AAK16735.1
AF342816 mRNA Translation: AAK16736.1
AF468213 mRNA Translation: AAL77076.1
AL359921 Genomic DNA No translation available.
BC015818 mRNA Translation: AAH15818.1 Different initiation.
BC016486 mRNA Translation: AAH16486.2 Different initiation.
CCDSiCCDS1611.1 [O00214-2]
CCDS1612.1 [O00214-1]
PIRiJC6147
RefSeqiNP_006490.3, NM_006499.4 [O00214-2]
NP_963837.1, NM_201543.2 [O00214-1]
NP_963838.1, NM_201544.2 [O00214-1]
NP_963839.1, NM_201545.2 [O00214-2]
UniGeneiHs.4082
Hs.708114
Hs.735982

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YRONMR-A176-317[»]
2YV8X-ray1.92A1-152[»]
2YXSX-ray2.13A1-152[»]
3AP4X-ray2.33A/B/C/D1-154[»]
3AP5X-ray1.92A1-154[»]
3AP6X-ray1.58A/B/C/D1-154[»]
3AP7X-ray1.53A1-154[»]
3AP9X-ray1.33A1-154[»]
3APBX-ray1.95A/B1-154[»]
3OJBX-ray3.01A/B/C/D186-315[»]
3VKLX-ray2.55A/B1-155[»]
A/B184-317[»]
3VKMX-ray2.98A/B1-155[»]
A/B184-317[»]
3VKNX-ray1.98A/B1-153[»]
3VKOX-ray2.08A/B1-153[»]
4BMBX-ray1.35A4-153[»]
4BMEX-ray2.00A/B4-155[»]
4FQZX-ray2.80A1-155[»]
A184-317[»]
4GXLX-ray2.02A186-317[»]
4HANX-ray2.55A/B1-155[»]
A/B184-317[»]
5GZCX-ray1.08A7-158[»]
5GZDX-ray1.19A7-154[»]
5GZEX-ray1.32A7-154[»]
5GZFX-ray2.00A1-186[»]
5GZGX-ray2.00A1-186[»]
5T7IX-ray2.00A1-155[»]
5T7SX-ray1.90A1-155[»]
5T7TX-ray1.96A1-155[»]
5T7UX-ray1.58A1-155[»]
5VWGX-ray2.10A1-155[»]
ProteinModelPortaliO00214
SMRiO00214
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110155, 114 interactors
IntActiO00214, 11 interactors
MINTiO00214

Chemistry databases

BindingDBiO00214
ChEMBLiCHEMBL5475

Protein family/group databases

UniLectiniO00214

PTM databases

iPTMnetiO00214
PhosphoSitePlusiO00214

Polymorphism and mutation databases

BioMutaiLGALS8

Proteomic databases

EPDiO00214
jPOSTiO00214
MaxQBiO00214
PeptideAtlasiO00214
PRIDEiO00214
ProteomicsDBi47785
47786 [O00214-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
3964
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341872; ENSP00000342139; ENSG00000116977 [O00214-1]
ENST00000352231; ENSP00000309576; ENSG00000116977 [O00214-2]
ENST00000366584; ENSP00000355543; ENSG00000116977 [O00214-1]
ENST00000450372; ENSP00000408657; ENSG00000116977 [O00214-2]
ENST00000526589; ENSP00000435460; ENSG00000116977 [O00214-2]
ENST00000526634; ENSP00000437040; ENSG00000116977 [O00214-1]
ENST00000527974; ENSP00000431398; ENSG00000116977 [O00214-2]
GeneIDi3964
KEGGihsa:3964
UCSCiuc001hxw.3 human [O00214-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3964
DisGeNETi3964
EuPathDBiHostDB:ENSG00000116977.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LGALS8
HGNCiHGNC:6569 LGALS8
HPAiHPA012734
HPA030491
MIMi606099 gene
neXtProtiNX_O00214
OpenTargetsiENSG00000116977
PharmGKBiPA30346

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000155727
HOVERGENiHBG002412
InParanoidiO00214
KOiK06832
OMAiHASDYFK
OrthoDBi829777at2759
PhylomeDBiO00214
TreeFamiTF315551

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LGALS8 human
EvolutionaryTraceiO00214

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Galectin-8
LGALS8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3964

Protein Ontology

More...
PROi
PR:O00214

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000116977 Expressed in 225 organ(s), highest expression level in sperm
ExpressionAtlasiO00214 baseline and differential
GenevisibleiO00214 HS

Family and domain databases

CDDicd00070 GLECT, 2 hits
InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR030638 Galectin_8
IPR001079 Galectin_CRD
PANTHERiPTHR11346:SF22 PTHR11346:SF22, 1 hit
PfamiView protein in Pfam
PF00337 Gal-bind_lectin, 2 hits
SMARTiView protein in SMART
SM00908 Gal-bind_lectin, 2 hits
SM00276 GLECT, 2 hits
SUPFAMiSSF49899 SSF49899, 2 hits
PROSITEiView protein in PROSITE
PS51304 GALECTIN, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLEG8_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00214
Secondary accession number(s): O15215
, Q5T3P5, Q5T3Q4, Q8TEV1, Q96B92, Q9BXC8, Q9H584, Q9H585, Q9UEZ6, Q9UP32, Q9UP33, Q9UP34
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 23, 2010
Last modified: January 16, 2019
This is version 182 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again