Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Galectin-8

Gene

LGALS8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy (PubMed:22246324, PubMed:28077878). Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture (PubMed:22246324, PubMed:28077878). Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52 (PubMed:22246324, PubMed:28077878). Required to restrict infection of bacterial invasion such as S.typhimurium (PubMed:22246324). Also required to restrict infection of Picornaviridae viruses (PubMed:28077878). Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans (PubMed:21288902).3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei59Critical for binding to sialylated and sulfated oligosaccharides1 Publication1
Binding sitei69Carbohydrate1 Publication1
Binding sitei79Carbohydrate1 Publication1
Binding sitei89Carbohydrate1 Publication1

GO - Molecular functioni

  • carbohydrate binding Source: GO_Central
  • integrin binding Source: UniProtKB

GO - Biological processi

  • cellular response to virus Source: UniProtKB
  • lymphatic endothelial cell migration Source: UniProtKB
  • xenophagy Source: UniProtKB

Keywordsi

Biological processAutophagy
LigandLectin

Protein family/group databases

UniLectiniO00214

Names & Taxonomyi

Protein namesi
Recommended name:
Galectin-81 Publication
Short name:
Gal-8
Alternative name(s):
Po66 carbohydrate-binding protein
Short name:
Po66-CBP
Prostate carcinoma tumor antigen 11 Publication
Short name:
PCTA-11 Publication
Gene namesi
Name:LGALS8Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000116977.18
HGNCiHGNC:6569 LGALS8
MIMi606099 gene
neXtProtiNX_O00214

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi69R → H: Abolishes localization to cytoplasmic vesicles in case of infection by S.typhimurium. 1 Publication1
Mutagenesisi190R → H: Does not affect localization to cytoplasmic vesicles in case of infection by S.typhimurium. 1 Publication1

Organism-specific databases

DisGeNETi3964
OpenTargetsiENSG00000116977
PharmGKBiPA30346

Chemistry databases

ChEMBLiCHEMBL5475

Polymorphism and mutation databases

BioMutaiLGALS8

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000769431 – 317Galectin-8Add BLAST317

Proteomic databases

EPDiO00214
MaxQBiO00214
PeptideAtlasiO00214
PRIDEiO00214
ProteomicsDBi47785
47786 [O00214-2]

PTM databases

iPTMnetiO00214
PhosphoSitePlusiO00214

Expressioni

Tissue specificityi

Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.

Gene expression databases

BgeeiENSG00000116977 Expressed in 225 organ(s), highest expression level in sperm
ExpressionAtlasiO00214 baseline and differential
GenevisibleiO00214 HS

Organism-specific databases

HPAiHPA012734
HPA030491

Interactioni

Subunit structurei

Homodimer (PubMed:21288902, Ref. 15). Interacts with CALCOCO2/NDP52 (PubMed:22246324). Interacts with PDPN; the interaction is glycosylation-dependent; may participate to connection of the lymphatic endothelium to the surrounding extracellular matrix.3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi110155, 114 interactors
IntActiO00214, 11 interactors
MINTiO00214

Chemistry databases

BindingDBiO00214

Structurei

Secondary structure

1317
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO00214
SMRiO00214
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO00214

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini19 – 152Galectin 1PROSITE-ProRule annotationAdd BLAST134
Domaini187 – 317Galectin 2PROSITE-ProRule annotationAdd BLAST131

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni249 – 255Beta-galactoside bindingBy similarity7

Domaini

Contains two homologous but distinct carbohydrate-binding domains.

Keywords - Domaini

Repeat

Phylogenomic databases

GeneTreeiENSGT00760000119105
HOVERGENiHBG002412
InParanoidiO00214
KOiK06832
OMAiHASDYFK
OrthoDBiEOG091G0WP8
PhylomeDBiO00214
TreeFamiTF315551

Family and domain databases

CDDicd00070 GLECT, 2 hits
InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR030638 Galectin_8
IPR001079 Galectin_CRD
PANTHERiPTHR11346:SF22 PTHR11346:SF22, 1 hit
PfamiView protein in Pfam
PF00337 Gal-bind_lectin, 2 hits
SMARTiView protein in SMART
SM00908 Gal-bind_lectin, 2 hits
SM00276 GLECT, 2 hits
SUPFAMiSSF49899 SSF49899, 2 hits
PROSITEiView protein in PROSITE
PS51304 GALECTIN, 2 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O00214-1) [UniParc]FASTAAdd to basket
Also known as: I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMLSLNNLQN IIYNPVIPFV GTIPDQLDPG TLIVIRGHVP SDADRFQVDL
60 70 80 90 100
QNGSSMKPRA DVAFHFNPRF KRAGCIVCNT LINEKWGREE ITYDTPFKRE
110 120 130 140 150
KSFEIVIMVL KDKFQVAVNG KHTLLYGHRI GPEKIDTLGI YGKVNIHSIG
160 170 180 190 200
FSFSSDLQST QASSLELTEI SRENVPKSGT PQLRLPFAAR LNTPMGPGRT
210 220 230 240 250
VVVKGEVNAN AKSFNVDLLA GKSKDIALHL NPRLNIKAFV RNSFLQESWG
260 270 280 290 300
EEERNITSFP FSPGMYFEMI IYCDVREFKV AVNGVHSLEY KHRFKELSSI
310
DTLEINGDIH LLEVRSW
Length:317
Mass (Da):35,808
Last modified:March 23, 2010 - v4
Checksum:iAA13116AC5C0D69A
GO
Isoform 2 (identifier: O00214-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-183: L → LPSNRGGDISKIAPRTVYTKSKDSTVNHTLTCTKIPPMNYVSK

Show »
Length:359
Mass (Da):40,397
Checksum:i39BED76B4115A798
GO

Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T3P9Q5T3P9_HUMAN
Galectin
LGALS8
208Annotation score:
B1ANM0B1ANM0_HUMAN
Galectin
LGALS8
167Annotation score:
E9PRN3E9PRN3_HUMAN
Galectin
LGALS8
121Annotation score:
E9PJ77E9PJ77_HUMAN
Galectin
LGALS8
106Annotation score:
H7BXD8H7BXD8_HUMAN
Galectin
LGALS8
175Annotation score:
E9PN19E9PN19_HUMAN
Galectin
LGALS8
290Annotation score:
F6V2D4F6V2D4_HUMAN
Galectin
LGALS8
300Annotation score:
E9PNC2E9PNC2_HUMAN
Galectin-8
LGALS8
53Annotation score:
E9PPL1E9PPL1_HUMAN
Galectin-8
LGALS8
43Annotation score:
E9PPM4E9PPM4_HUMAN
Galectin-8
LGALS8
53Annotation score:

Sequence cautioni

The sequence AAB51605 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAD45402 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAD45403 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAD45404 differs from that shown. Probable cloning artifact.Curated
The sequence AAD45404 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH15818 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH16486 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti14N → S in AAL77076 (Ref. 8) Curated1
Sequence conflicti98 – 100KRE → QKEK in CAA62904 (Ref. 2) Curated3
Sequence conflicti112D → A in CAA62904 (Ref. 2) Curated1
Sequence conflicti171S → V in AAB51605 (PubMed:8692978).Curated1
Sequence conflicti199R → G in AAL77076 (Ref. 8) Curated1
Sequence conflicti204K → Q in AAB51605 (PubMed:8692978).Curated1
Sequence conflicti225D → H in AAL77076 (Ref. 8) Curated1
Sequence conflicti259F → L in AAK16736 (Ref. 7) Curated1
Isoform 2 (identifier: O00214-2)
Sequence conflicti220M → T in AAL77076 (Ref. 8) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01299019F → Y4 PublicationsCorresponds to variant dbSNP:rs1126407Ensembl.1
Natural variantiVAR_00971036R → C4 PublicationsCorresponds to variant dbSNP:rs1041935Ensembl.1
Natural variantiVAR_01299156M → V5 PublicationsCorresponds to variant dbSNP:rs1041937Ensembl.1
Natural variantiVAR_063506184R → S4 PublicationsCorresponds to variant dbSNP:rs2243525Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_003094183L → LPSNRGGDISKIAPRTVYTK SKDSTVNHTLTCTKIPPMNY VSK in isoform 2. 4 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L78132 mRNA Translation: AAB51605.1 Different initiation.
X91790 mRNA Translation: CAA62904.1
AF074000 mRNA Translation: AAD45402.1 Different initiation.
AF074001 mRNA Translation: AAD45403.1 Different initiation.
AF074002 mRNA Translation: AAD45404.1 Sequence problems.
AF193806, AF193805 Genomic DNA Translation: AAF19370.1
AF342815 mRNA Translation: AAK16735.1
AF342816 mRNA Translation: AAK16736.1
AF468213 mRNA Translation: AAL77076.1
AL359921 Genomic DNA No translation available.
BC015818 mRNA Translation: AAH15818.1 Different initiation.
BC016486 mRNA Translation: AAH16486.2 Different initiation.
CCDSiCCDS1611.1 [O00214-2]
CCDS1612.1 [O00214-1]
PIRiJC6147
RefSeqiNP_006490.3, NM_006499.4 [O00214-2]
NP_963837.1, NM_201543.2 [O00214-1]
NP_963838.1, NM_201544.2 [O00214-1]
NP_963839.1, NM_201545.2 [O00214-2]
UniGeneiHs.4082
Hs.708114
Hs.735982

Genome annotation databases

EnsembliENST00000341872; ENSP00000342139; ENSG00000116977 [O00214-1]
ENST00000352231; ENSP00000309576; ENSG00000116977 [O00214-2]
ENST00000366584; ENSP00000355543; ENSG00000116977 [O00214-1]
ENST00000450372; ENSP00000408657; ENSG00000116977 [O00214-2]
ENST00000526589; ENSP00000435460; ENSG00000116977 [O00214-2]
ENST00000526634; ENSP00000437040; ENSG00000116977 [O00214-1]
ENST00000527974; ENSP00000431398; ENSG00000116977 [O00214-2]
GeneIDi3964
KEGGihsa:3964
UCSCiuc001hxw.3 human [O00214-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Galectin-8 C-terminal CRD

Functional Glycomics Gateway - Glycan Binding

Galectin-8 long isoform

Functional Glycomics Gateway - Glycan Binding

Galectin-8 long isoform

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L78132 mRNA Translation: AAB51605.1 Different initiation.
X91790 mRNA Translation: CAA62904.1
AF074000 mRNA Translation: AAD45402.1 Different initiation.
AF074001 mRNA Translation: AAD45403.1 Different initiation.
AF074002 mRNA Translation: AAD45404.1 Sequence problems.
AF193806, AF193805 Genomic DNA Translation: AAF19370.1
AF342815 mRNA Translation: AAK16735.1
AF342816 mRNA Translation: AAK16736.1
AF468213 mRNA Translation: AAL77076.1
AL359921 Genomic DNA No translation available.
BC015818 mRNA Translation: AAH15818.1 Different initiation.
BC016486 mRNA Translation: AAH16486.2 Different initiation.
CCDSiCCDS1611.1 [O00214-2]
CCDS1612.1 [O00214-1]
PIRiJC6147
RefSeqiNP_006490.3, NM_006499.4 [O00214-2]
NP_963837.1, NM_201543.2 [O00214-1]
NP_963838.1, NM_201544.2 [O00214-1]
NP_963839.1, NM_201545.2 [O00214-2]
UniGeneiHs.4082
Hs.708114
Hs.735982

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YRONMR-A176-317[»]
2YV8X-ray1.92A1-152[»]
2YXSX-ray2.13A1-152[»]
3AP4X-ray2.33A/B/C/D1-154[»]
3AP5X-ray1.92A1-154[»]
3AP6X-ray1.58A/B/C/D1-154[»]
3AP7X-ray1.53A1-154[»]
3AP9X-ray1.33A1-154[»]
3APBX-ray1.95A/B1-154[»]
3OJBX-ray3.01A/B/C/D186-315[»]
3VKLX-ray2.55A/B1-155[»]
A/B184-317[»]
3VKMX-ray2.98A/B1-155[»]
A/B184-317[»]
3VKNX-ray1.98A/B1-153[»]
3VKOX-ray2.08A/B1-153[»]
4BMBX-ray1.35A4-153[»]
4BMEX-ray2.00A/B4-155[»]
4FQZX-ray2.80A1-155[»]
A184-317[»]
4GXLX-ray2.02A186-317[»]
4HANX-ray2.55A/B1-155[»]
A/B184-317[»]
5GZCX-ray1.08A7-158[»]
5GZDX-ray1.19A7-154[»]
5GZEX-ray1.32A7-154[»]
5GZFX-ray2.00A1-186[»]
5GZGX-ray2.00A1-186[»]
5T7IX-ray2.00A1-155[»]
5T7SX-ray1.90A1-155[»]
5T7TX-ray1.96A1-155[»]
5T7UX-ray1.58A1-155[»]
5VWGX-ray2.10A1-155[»]
ProteinModelPortaliO00214
SMRiO00214
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110155, 114 interactors
IntActiO00214, 11 interactors
MINTiO00214

Chemistry databases

BindingDBiO00214
ChEMBLiCHEMBL5475

Protein family/group databases

UniLectiniO00214

PTM databases

iPTMnetiO00214
PhosphoSitePlusiO00214

Polymorphism and mutation databases

BioMutaiLGALS8

Proteomic databases

EPDiO00214
MaxQBiO00214
PeptideAtlasiO00214
PRIDEiO00214
ProteomicsDBi47785
47786 [O00214-2]

Protocols and materials databases

DNASUi3964
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341872; ENSP00000342139; ENSG00000116977 [O00214-1]
ENST00000352231; ENSP00000309576; ENSG00000116977 [O00214-2]
ENST00000366584; ENSP00000355543; ENSG00000116977 [O00214-1]
ENST00000450372; ENSP00000408657; ENSG00000116977 [O00214-2]
ENST00000526589; ENSP00000435460; ENSG00000116977 [O00214-2]
ENST00000526634; ENSP00000437040; ENSG00000116977 [O00214-1]
ENST00000527974; ENSP00000431398; ENSG00000116977 [O00214-2]
GeneIDi3964
KEGGihsa:3964
UCSCiuc001hxw.3 human [O00214-1]

Organism-specific databases

CTDi3964
DisGeNETi3964
EuPathDBiHostDB:ENSG00000116977.18
GeneCardsiLGALS8
HGNCiHGNC:6569 LGALS8
HPAiHPA012734
HPA030491
MIMi606099 gene
neXtProtiNX_O00214
OpenTargetsiENSG00000116977
PharmGKBiPA30346
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000119105
HOVERGENiHBG002412
InParanoidiO00214
KOiK06832
OMAiHASDYFK
OrthoDBiEOG091G0WP8
PhylomeDBiO00214
TreeFamiTF315551

Miscellaneous databases

ChiTaRSiLGALS8 human
EvolutionaryTraceiO00214
GeneWikiiGalectin-8
LGALS8
GenomeRNAii3964
PROiPR:O00214
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000116977 Expressed in 225 organ(s), highest expression level in sperm
ExpressionAtlasiO00214 baseline and differential
GenevisibleiO00214 HS

Family and domain databases

CDDicd00070 GLECT, 2 hits
InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR030638 Galectin_8
IPR001079 Galectin_CRD
PANTHERiPTHR11346:SF22 PTHR11346:SF22, 1 hit
PfamiView protein in Pfam
PF00337 Gal-bind_lectin, 2 hits
SMARTiView protein in SMART
SM00908 Gal-bind_lectin, 2 hits
SM00276 GLECT, 2 hits
SUPFAMiSSF49899 SSF49899, 2 hits
PROSITEiView protein in PROSITE
PS51304 GALECTIN, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiLEG8_HUMAN
AccessioniPrimary (citable) accession number: O00214
Secondary accession number(s): O15215
, Q5T3P5, Q5T3Q4, Q8TEV1, Q96B92, Q9BXC8, Q9H584, Q9H585, Q9UEZ6, Q9UP32, Q9UP33, Q9UP34
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 23, 2010
Last modified: September 12, 2018
This is version 179 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again