Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic acyl coenzyme A thioester hydrolase

Gene

ACOT7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May play an important physiological function in brain. May play a regulatory role by modulating the cellular levels of fatty acyl-CoA ligands for certain transcription factors as well as the substrates for fatty acid metabolizing enzymes, contributing to lipid homeostasis. Has broad specificity, active towards fatty acyl-CoAs with chain-lengths of C8-C18. Has a maximal activity toward palmitoyl-CoA.

Catalytic activityi

Palmitoyl-CoA + H2O = CoA + palmitate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei66By similarity1
Active sitei255By similarity1

GO - Molecular functioni

  • acyl-CoA hydrolase activity Source: GO_Central
  • carboxylic ester hydrolase activity Source: UniProtKB-KW
  • fatty-acyl-CoA binding Source: BHF-UCL
  • long-chain fatty acyl-CoA binding Source: BHF-UCL
  • myristoyl-CoA hydrolase activity Source: UniProtKB-EC
  • palmitoyl-CoA hydrolase activity Source: BHF-UCL
  • protein homodimerization activity Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Serine esterase

Enzyme and pathway databases

BRENDAi3.1.2.2 2681
3.1.2.20 2681
ReactomeiR-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation
SABIO-RKiO00154

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic acyl coenzyme A thioester hydrolase (EC:3.1.2.2)
Alternative name(s):
Acyl-CoA thioesterase 7
Brain acyl-CoA hydrolase
Short name:
BACH
CTE-IIa
Short name:
CTE-II
Long chain acyl-CoA thioester hydrolase
Gene namesi
Name:ACOT7
Synonyms:BACH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000097021.19
HGNCiHGNC:24157 ACOT7
MIMi602587 gene
neXtProtiNX_O00154

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

Pathology & Biotechi

Organism-specific databases

DisGeNETi11332
OpenTargetsiENSG00000097021
PharmGKBiPA142672655

Polymorphism and mutation databases

BioMutaiACOT7

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000538061 – 380Cytosolic acyl coenzyme A thioester hydrolaseAdd BLAST380

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei168N6-acetyllysineCombined sources1
Modified residuei198N6-acetyllysineCombined sources1
Modified residuei283N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiO00154
MaxQBiO00154
PaxDbiO00154
PeptideAtlasiO00154
PRIDEiO00154
ProteomicsDBi47737
47738 [O00154-2]
47739 [O00154-3]
47740 [O00154-4]
47741 [O00154-5]
47742 [O00154-6]
TopDownProteomicsiO00154-1 [O00154-1]

2D gel databases

UCD-2DPAGEiO00154

PTM databases

iPTMnetiO00154
PhosphoSitePlusiO00154
SwissPalmiO00154

Expressioni

Tissue specificityi

Isoform 4 is expressed exclusively in brain.1 Publication

Gene expression databases

BgeeiENSG00000097021 Expressed in 199 organ(s), highest expression level in anterior cingulate cortex
ExpressionAtlasiO00154 baseline and differential
GenevisibleiO00154 HS

Organism-specific databases

HPAiHPA025735
HPA025762

Interactioni

Subunit structurei

Homohexamer.By similarity

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116460, 42 interactors
IntActiO00154, 29 interactors
MINTiO00154
STRINGi9606.ENSP00000367086

Structurei

Secondary structure

1380
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO00154
SMRiO00154
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO00154

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini50 – 168HotDog ACOT-type 1PROSITE-ProRule annotationAdd BLAST119
Domaini224 – 338HotDog ACOT-type 2PROSITE-ProRule annotationAdd BLAST115

Domaini

Both HotDog ACOT-type hydrolase domains are required for efficient activity.By similarity

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG2763 Eukaryota
COG1607 LUCA
GeneTreeiENSGT00760000119297
HOGENOMiHOG000007663
HOVERGENiHBG036928
InParanoidiO00154
KOiK17360
OMAiPTDVNWG
OrthoDBiEOG091G0CG4
PhylomeDBiO00154
TreeFamiTF329579

Family and domain databases

InterProiView protein in InterPro
IPR033120 HOTDOG_ACOT
IPR029069 HotDog_dom_sf
IPR006683 Thioestr_dom
PfamiView protein in Pfam
PF03061 4HBT, 2 hits
SUPFAMiSSF54637 SSF54637, 2 hits
PROSITEiView protein in PROSITE
PS51770 HOTDOG_ACOT, 2 hits

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O00154-1) [UniParc]FASTAAdd to basket
Also known as: B, HBACHb

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLLARALRL CEFGRQASSR RLVAGQGCVG PRRGCCAPVQ VVGPRADLPP
60 70 80 90 100
CGACITGRIM RPDDANVAGN VHGGTILKMI EEAGAIISTR HCNSQNGERC
110 120 130 140 150
VAALARVERT DFLSPMCIGE VAHVSAEITY TSKHSVEVQV NVMSENILTG
160 170 180 190 200
AKKLTNKATL WYVPLSLKNV DKVLEVPPVV YSRQEQEEEG RKRYEAQKLE
210 220 230 240 250
RMETKWRNGD IVQPVLNPEP NTVSYSQSSL IHLVGPSDCT LHGFVHGGVT
260 270 280 290 300
MKLMDEVAGI VAARHCKTNI VTASVDAINF HDKIRKGCVI TISGRMTFTS
310 320 330 340 350
NKSMEIEVLV DADPVVDSSQ KRYRAASAFF TYVSLSQEGR SLPVPQLVPE
360 370 380
TEDEKKRFEE GKGRYLQMKA KRQGHAEPQP
Length:380
Mass (Da):41,796
Last modified:February 12, 2003 - v3
Checksum:iBDD75D62A60095BC
GO
Isoform 2 (identifier: O00154-2) [UniParc]FASTAAdd to basket
Also known as: A-X, hBACHa-X

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC
     287-288: GC → AP
     289-380: Missing.

Show »
Length:246
Mass (Da):27,041
Checksum:i4CDCAD44CE427904
GO
Isoform 3 (identifier: O00154-3) [UniParc]FASTAAdd to basket
Also known as: A-Xi, hBACHa-Xi

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC
     287-380: GCVITISGRM...KRQGHAEPQP → AHVMPAGADH...HLGTHDLHEQ

Show »
Length:283
Mass (Da):30,977
Checksum:iC21B4544638BA031
GO
Isoform 4 (identifier: O00154-4) [UniParc]FASTAAdd to basket
Also known as: A, hBACHa

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC

Note: Major isoform.
Show »
Length:338
Mass (Da):37,420
Checksum:i95E4CB4B0A7AF34C
GO
Isoform 5 (identifier: O00154-5) [UniParc]FASTAAdd to basket
Also known as: C, hBACHc

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: MKLLARALRL...PPCGACITGR → MLLLRRSLSLNVLRKEVDRACFGEKAKQ

Show »
Length:350
Mass (Da):38,991
Checksum:iD8FA42B2583051BA
GO
Isoform 6 (identifier: O00154-6) [UniParc]FASTAAdd to basket
Also known as: D, hBACHd

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MAFQLS

Show »
Length:329
Mass (Da):36,568
Checksum:iECEB0F657ADF6E25
GO
Isoform 7 (identifier: O00154-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRL...LPPCGACITG → MARPGLIHSA...VETPSAIQIC

Show »
Length:370
Mass (Da):40,455
Checksum:i28F0088FFF813417
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EKP8K7EKP8_HUMAN
Cytosolic acyl coenzyme A thioester...
ACOT7
279Annotation score:

Sequence cautioni

The sequence AAB61211 differs from that shown. Reason: Frameshift at position 371.Curated
The sequence AAH17365 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti82E → G in BAG51874 (PubMed:14702039).Curated1
Sequence conflicti371 – 372KR → DD in AAB61211 (Ref. 3) Curated2
Sequence conflicti377 – 378EP → DA in AAB61211 (Ref. 3) Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0001511 – 58MKLLA…CITGR → MLLLRRSLSLNVLRKEVDRA CFGEKAKQ in isoform 5. 2 PublicationsAdd BLAST58
Alternative sequenceiVSP_0001521 – 57MKLLA…ACITG → MSGPDVETPSAIQIC in isoform 2, isoform 3 and isoform 4. 6 PublicationsAdd BLAST57
Alternative sequenceiVSP_0001531 – 57MKLLA…ACITG → MAFQLS in isoform 6. 2 PublicationsAdd BLAST57
Alternative sequenceiVSP_0470941 – 57MKLLA…ACITG → MARPGLIHSAPGLPDTCALL QPPAASAAAAPSMSGPDVET PSAIQIC in isoform 7. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_000154287 – 380GCVIT…AEPQP → AHVMPAGADHTAPSSSPSTG TKCSLLRHHHLGTHDLHEQ in isoform 3. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_000155287 – 288GC → AP in isoform 2. 1 Publication2
Alternative sequenceiVSP_000156289 – 380Missing in isoform 2. 1 PublicationAdd BLAST92

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D88894 mRNA Translation: BAA24350.1
AB074415 mRNA Translation: BAC20174.1
AB074416 mRNA Translation: BAC20175.1
AB074417 mRNA Translation: BAC20176.1
AB074418 mRNA Translation: BAC20177.1
AB074419 mRNA Translation: BAC20178.1
U91316 mRNA Translation: AAB61211.1 Frameshift.
BT006888 mRNA Translation: AAP35534.1
AK289572 mRNA Translation: BAF82261.1
AK290097 mRNA Translation: BAF82786.1
AK291583 mRNA Translation: BAF84272.1
AK292202 mRNA Translation: BAF84891.1
AK057168 mRNA Translation: BAG51874.1
AL031847 Genomic DNA No translation available.
AL031848 Genomic DNA No translation available.
CH471130 Genomic DNA Translation: EAW71528.1
CH471130 Genomic DNA Translation: EAW71529.1
CH471130 Genomic DNA Translation: EAW71530.1
BC017365 mRNA Translation: AAH17365.2 Different initiation.
CCDSiCCDS30573.1 [O00154-7]
CCDS65.1 [O00154-1]
CCDS66.1 [O00154-5]
CCDS67.1 [O00154-6]
PIRiJC7161
RefSeqiNP_009205.3, NM_007274.3 [O00154-7]
NP_863654.1, NM_181864.2 [O00154-1]
NP_863655.1, NM_181865.2 [O00154-5]
NP_863656.1, NM_181866.2 [O00154-6]
UniGeneiHs.126137

Genome annotation databases

EnsembliENST00000361521; ENSP00000354615; ENSG00000097021 [O00154-7]
ENST00000377842; ENSP00000367073; ENSG00000097021 [O00154-6]
ENST00000377845; ENSP00000367076; ENSG00000097021 [O00154-5]
ENST00000377855; ENSP00000367086; ENSG00000097021 [O00154-1]
ENST00000377860; ENSP00000367091; ENSG00000097021 [O00154-3]
ENST00000418124; ENSP00000402532; ENSG00000097021 [O00154-2]
ENST00000545482; ENSP00000439218; ENSG00000097021 [O00154-7]
ENST00000608083; ENSP00000476610; ENSG00000097021 [O00154-4]
GeneIDi11332
KEGGihsa:11332
UCSCiuc001amq.4 human [O00154-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D88894 mRNA Translation: BAA24350.1
AB074415 mRNA Translation: BAC20174.1
AB074416 mRNA Translation: BAC20175.1
AB074417 mRNA Translation: BAC20176.1
AB074418 mRNA Translation: BAC20177.1
AB074419 mRNA Translation: BAC20178.1
U91316 mRNA Translation: AAB61211.1 Frameshift.
BT006888 mRNA Translation: AAP35534.1
AK289572 mRNA Translation: BAF82261.1
AK290097 mRNA Translation: BAF82786.1
AK291583 mRNA Translation: BAF84272.1
AK292202 mRNA Translation: BAF84891.1
AK057168 mRNA Translation: BAG51874.1
AL031847 Genomic DNA No translation available.
AL031848 Genomic DNA No translation available.
CH471130 Genomic DNA Translation: EAW71528.1
CH471130 Genomic DNA Translation: EAW71529.1
CH471130 Genomic DNA Translation: EAW71530.1
BC017365 mRNA Translation: AAH17365.2 Different initiation.
CCDSiCCDS30573.1 [O00154-7]
CCDS65.1 [O00154-1]
CCDS66.1 [O00154-5]
CCDS67.1 [O00154-6]
PIRiJC7161
RefSeqiNP_009205.3, NM_007274.3 [O00154-7]
NP_863654.1, NM_181864.2 [O00154-1]
NP_863655.1, NM_181865.2 [O00154-5]
NP_863656.1, NM_181866.2 [O00154-6]
UniGeneiHs.126137

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2QQ2X-ray2.80A/B/C/D/E/F/G/H/I/J/K/L209-378[»]
ProteinModelPortaliO00154
SMRiO00154
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116460, 42 interactors
IntActiO00154, 29 interactors
MINTiO00154
STRINGi9606.ENSP00000367086

PTM databases

iPTMnetiO00154
PhosphoSitePlusiO00154
SwissPalmiO00154

Polymorphism and mutation databases

BioMutaiACOT7

2D gel databases

UCD-2DPAGEiO00154

Proteomic databases

EPDiO00154
MaxQBiO00154
PaxDbiO00154
PeptideAtlasiO00154
PRIDEiO00154
ProteomicsDBi47737
47738 [O00154-2]
47739 [O00154-3]
47740 [O00154-4]
47741 [O00154-5]
47742 [O00154-6]
TopDownProteomicsiO00154-1 [O00154-1]

Protocols and materials databases

DNASUi11332
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361521; ENSP00000354615; ENSG00000097021 [O00154-7]
ENST00000377842; ENSP00000367073; ENSG00000097021 [O00154-6]
ENST00000377845; ENSP00000367076; ENSG00000097021 [O00154-5]
ENST00000377855; ENSP00000367086; ENSG00000097021 [O00154-1]
ENST00000377860; ENSP00000367091; ENSG00000097021 [O00154-3]
ENST00000418124; ENSP00000402532; ENSG00000097021 [O00154-2]
ENST00000545482; ENSP00000439218; ENSG00000097021 [O00154-7]
ENST00000608083; ENSP00000476610; ENSG00000097021 [O00154-4]
GeneIDi11332
KEGGihsa:11332
UCSCiuc001amq.4 human [O00154-1]

Organism-specific databases

CTDi11332
DisGeNETi11332
EuPathDBiHostDB:ENSG00000097021.19
GeneCardsiACOT7
HGNCiHGNC:24157 ACOT7
HPAiHPA025735
HPA025762
MIMi602587 gene
neXtProtiNX_O00154
OpenTargetsiENSG00000097021
PharmGKBiPA142672655
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2763 Eukaryota
COG1607 LUCA
GeneTreeiENSGT00760000119297
HOGENOMiHOG000007663
HOVERGENiHBG036928
InParanoidiO00154
KOiK17360
OMAiPTDVNWG
OrthoDBiEOG091G0CG4
PhylomeDBiO00154
TreeFamiTF329579

Enzyme and pathway databases

BRENDAi3.1.2.2 2681
3.1.2.20 2681
ReactomeiR-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation
SABIO-RKiO00154

Miscellaneous databases

ChiTaRSiACOT7 human
EvolutionaryTraceiO00154
GeneWikiiACOT7
GenomeRNAii11332
PROiPR:O00154
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000097021 Expressed in 199 organ(s), highest expression level in anterior cingulate cortex
ExpressionAtlasiO00154 baseline and differential
GenevisibleiO00154 HS

Family and domain databases

InterProiView protein in InterPro
IPR033120 HOTDOG_ACOT
IPR029069 HotDog_dom_sf
IPR006683 Thioestr_dom
PfamiView protein in Pfam
PF03061 4HBT, 2 hits
SUPFAMiSSF54637 SSF54637, 2 hits
PROSITEiView protein in PROSITE
PS51770 HOTDOG_ACOT, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiBACH_HUMAN
AccessioniPrimary (citable) accession number: O00154
Secondary accession number(s): A8K0K7
, A8K232, A8K6B8, A8K837, B3KQ12, O43703, Q53Y78, Q5JYL2, Q5JYL3, Q5JYL4, Q5JYL5, Q5JYL6, Q5TGR4, Q9UJM9, Q9Y539, Q9Y540
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 12, 2003
Last modified: November 7, 2018
This is version 175 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again