Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O00154 (BACH_HUMAN)

Protein

Cytosolic acyl coenzyme A thioester hydrolase

Gene

ACOT7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May play an important physiological function in brain. May play a regulatory role by modulating the cellular levels of fatty acyl-CoA ligands for certain transcription factors as well as the substrates for fatty acid metabolizing enzymes, contributing to lipid homeostasis. Has broad specificity, active towards fatty acyl-CoAs with chain-lengths of C8-C18. Has a maximal activity toward palmitoyl-CoA.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei66By similarity1
Active sitei255By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • acyl-CoA hydrolase activity Source: GO_Central
  • carboxylic ester hydrolase activity Source: UniProtKB-KW
  • fatty-acyl-CoA binding Source: BHF-UCL
  • long-chain fatty acyl-CoA binding Source: BHF-UCL
  • myristoyl-CoA hydrolase activity Source: UniProtKB-EC
  • palmitoyl-CoA hydrolase activity Source: BHF-UCL
  • protein homodimerization activity Source: BHF-UCL
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Serine esterase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.1.2.2 2681
3.1.2.20 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		O00154

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytosolic acyl coenzyme A thioester hydrolase (EC:3.1.2.2)
Alternative name(s):
Acyl-CoA thioesterase 7
Brain acyl-CoA hydrolase
Short name:
BACH
CTE-IIa
Short name:
CTE-II
Long chain acyl-CoA thioester hydrolase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ACOT7
Synonyms:BACH
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000097021.19

Human Gene Nomenclature Database

More...HGNCi		HGNC:24157 ACOT7

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602587 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O00154

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		11332

Open Targets

More...OpenTargetsi		ENSG00000097021

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142672655

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ACOT7

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000538061 – 380Cytosolic acyl coenzyme A thioester hydrolaseAdd BLAST380

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei168N6-acetyllysineCombined sources1
Modified residuei198N6-acetyllysineCombined sources1
Modified residuei283N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O00154

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O00154

MaxQB - The MaxQuant DataBase

More...MaxQBi		O00154

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O00154

PeptideAtlas

More...PeptideAtlasi		O00154

PRoteomics IDEntifications database

More...PRIDEi		O00154

ProteomicsDB human proteome resource

More...ProteomicsDBi		47737
47738 [O00154-2]
47739 [O00154-3]
47740 [O00154-4]
47741 [O00154-5]
47742 [O00154-6]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		O00154-1 [O00154-1]

2D gel databases

University College Dublin 2-DE Proteome Database

More...UCD-2DPAGEi		O00154

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O00154

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O00154

SwissPalm database of S-palmitoylation events

More...SwissPalmi		O00154

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 4 is expressed exclusively in brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000097021 Expressed in 199 organ(s), highest expression level in anterior cingulate cortex

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O00154 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O00154 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA025735
HPA025762

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homohexamer.By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		116460, 42 interactors

Protein interaction database and analysis system

More...IntActi		O00154, 29 interactors

Molecular INTeraction database

More...MINTi		O00154

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000367086

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1380
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2QQ2X-ray2.80A/B/C/D/E/F/G/H/I/J/K/L209-378[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		O00154

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O00154

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O00154

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini50 – 168HotDog ACOT-type 1PROSITE-ProRule annotationAdd BLAST119
Domaini224 – 338HotDog ACOT-type 2PROSITE-ProRule annotationAdd BLAST115

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Both HotDog ACOT-type hydrolase domains are required for efficient activity.By similarity

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2763 Eukaryota
COG1607 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155229

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000007663

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG036928

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O00154

KEGG Orthology (KO)

More...KOi		K17360

Identification of Orthologs from Complete Genome Data

More...OMAi		PTDVNWG

Database of Orthologous Groups

More...OrthoDBi		1069806at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O00154

TreeFam database of animal gene trees

More...TreeFami		TF329579

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR040170 Cytosol_ACT
IPR033120 HOTDOG_ACOT
IPR029069 HotDog_dom_sf
IPR006683 Thioestr_dom

The PANTHER Classification System

More...PANTHERi		PTHR11049 PTHR11049, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03061 4HBT, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54637 SSF54637, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51770 HOTDOG_ACOT, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O00154-1) [UniParc]FASTAAdd to basket
Also known as: B, HBACHb

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLLARALRL CEFGRQASSR RLVAGQGCVG PRRGCCAPVQ VVGPRADLPP 
        60         70         80         90        100
CGACITGRIM RPDDANVAGN VHGGTILKMI EEAGAIISTR HCNSQNGERC 
       110        120        130        140        150
VAALARVERT DFLSPMCIGE VAHVSAEITY TSKHSVEVQV NVMSENILTG 
       160        170        180        190        200
AKKLTNKATL WYVPLSLKNV DKVLEVPPVV YSRQEQEEEG RKRYEAQKLE 
       210        220        230        240        250
RMETKWRNGD IVQPVLNPEP NTVSYSQSSL IHLVGPSDCT LHGFVHGGVT 
       260        270        280        290        300
MKLMDEVAGI VAARHCKTNI VTASVDAINF HDKIRKGCVI TISGRMTFTS 
       310        320        330        340        350
NKSMEIEVLV DADPVVDSSQ KRYRAASAFF TYVSLSQEGR SLPVPQLVPE 
       360        370        380
TEDEKKRFEE GKGRYLQMKA KRQGHAEPQP
Length:380
Mass (Da):41,796
Last modified:February 12, 2003 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBDD75D62A60095BC
GO
Isoform 2 (identifier: O00154-2) [UniParc]FASTAAdd to basket
Also known as: A-X, hBACHa-X

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC
     287-288: GC → AP
     289-380: Missing.

Show »
Length:246
Mass (Da):27,041
Checksum:i4CDCAD44CE427904
GO
Isoform 3 (identifier: O00154-3) [UniParc]FASTAAdd to basket
Also known as: A-Xi, hBACHa-Xi

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC
     287-380: GCVITISGRM...KRQGHAEPQP → AHVMPAGADH...HLGTHDLHEQ

Show »
Length:283
Mass (Da):30,977
Checksum:iC21B4544638BA031
GO
Isoform 4 (identifier: O00154-4) [UniParc]FASTAAdd to basket
Also known as: A, hBACHa

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC

Note: Major isoform.
Show »
Length:338
Mass (Da):37,420
Checksum:i95E4CB4B0A7AF34C
GO
Isoform 5 (identifier: O00154-5) [UniParc]FASTAAdd to basket
Also known as: C, hBACHc

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: MKLLARALRL...PPCGACITGR → MLLLRRSLSLNVLRKEVDRACFGEKAKQ

Show »
Length:350
Mass (Da):38,991
Checksum:iD8FA42B2583051BA
GO
Isoform 6 (identifier: O00154-6) [UniParc]FASTAAdd to basket
Also known as: D, hBACHd

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MAFQLS

Show »
Length:329
Mass (Da):36,568
Checksum:iECEB0F657ADF6E25
GO
Isoform 7 (identifier: O00154-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRL...LPPCGACITG → MARPGLIHSA...VETPSAIQIC

Show »
Length:370
Mass (Da):40,455
Checksum:i28F0088FFF813417
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EKP8K7EKP8_HUMAN
Cytosolic acyl coenzyme A thioester...
ACOT7
279Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB61211 differs from that shown. Reason: Frameshift at position 371.Curated
The sequence AAH17365 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti82E → G in BAG51874 (PubMed:14702039).Curated1
Sequence conflicti371 – 372KR → DD in AAB61211 (Ref. 3) Curated2
Sequence conflicti377 – 378EP → DA in AAB61211 (Ref. 3) Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0001511 – 58MKLLA…CITGR → MLLLRRSLSLNVLRKEVDRA CFGEKAKQ in isoform 5. 2 PublicationsAdd BLAST58
Alternative sequenceiVSP_0001521 – 57MKLLA…ACITG → MSGPDVETPSAIQIC in isoform 2, isoform 3 and isoform 4. 6 PublicationsAdd BLAST57
Alternative sequenceiVSP_0001531 – 57MKLLA…ACITG → MAFQLS in isoform 6. 2 PublicationsAdd BLAST57
Alternative sequenceiVSP_0470941 – 57MKLLA…ACITG → MARPGLIHSAPGLPDTCALL QPPAASAAAAPSMSGPDVET PSAIQIC in isoform 7. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_000154287 – 380GCVIT…AEPQP → AHVMPAGADHTAPSSSPSTG TKCSLLRHHHLGTHDLHEQ in isoform 3. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_000155287 – 288GC → AP in isoform 2. 1 Publication2
Alternative sequenceiVSP_000156289 – 380Missing in isoform 2. 1 PublicationAdd BLAST92

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D88894 mRNA Translation: BAA24350.1
AB074415 mRNA Translation: BAC20174.1
AB074416 mRNA Translation: BAC20175.1
AB074417 mRNA Translation: BAC20176.1
AB074418 mRNA Translation: BAC20177.1
AB074419 mRNA Translation: BAC20178.1
U91316 mRNA Translation: AAB61211.1 Frameshift.
BT006888 mRNA Translation: AAP35534.1
AK289572 mRNA Translation: BAF82261.1
AK290097 mRNA Translation: BAF82786.1
AK291583 mRNA Translation: BAF84272.1
AK292202 mRNA Translation: BAF84891.1
AK057168 mRNA Translation: BAG51874.1
AL031847 Genomic DNA No translation available.
AL031848 Genomic DNA No translation available.
CH471130 Genomic DNA Translation: EAW71528.1
CH471130 Genomic DNA Translation: EAW71529.1
CH471130 Genomic DNA Translation: EAW71530.1
BC017365 mRNA Translation: AAH17365.2 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS30573.1 [O00154-7]
CCDS65.1 [O00154-1]
CCDS66.1 [O00154-5]
CCDS67.1 [O00154-6]

Protein sequence database of the Protein Information Resource

More...PIRi		JC7161

NCBI Reference Sequences

More...RefSeqi		NP_009205.3, NM_007274.3 [O00154-7]
NP_863654.1, NM_181864.2 [O00154-1]
NP_863655.1, NM_181865.2 [O00154-5]
NP_863656.1, NM_181866.2 [O00154-6]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.126137

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000361521; ENSP00000354615; ENSG00000097021 [O00154-7]
ENST00000377842; ENSP00000367073; ENSG00000097021 [O00154-6]
ENST00000377845; ENSP00000367076; ENSG00000097021 [O00154-5]
ENST00000377855; ENSP00000367086; ENSG00000097021 [O00154-1]
ENST00000377860; ENSP00000367091; ENSG00000097021 [O00154-3]
ENST00000418124; ENSP00000402532; ENSG00000097021 [O00154-2]
ENST00000545482; ENSP00000439218; ENSG00000097021 [O00154-7]
ENST00000608083; ENSP00000476610; ENSG00000097021 [O00154-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		11332

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:11332

UCSC genome browser

More...UCSCi		uc001amq.4 human [O00154-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D88894 mRNA Translation: BAA24350.1
AB074415 mRNA Translation: BAC20174.1
AB074416 mRNA Translation: BAC20175.1
AB074417 mRNA Translation: BAC20176.1
AB074418 mRNA Translation: BAC20177.1
AB074419 mRNA Translation: BAC20178.1
U91316 mRNA Translation: AAB61211.1 Frameshift.
BT006888 mRNA Translation: AAP35534.1
AK289572 mRNA Translation: BAF82261.1
AK290097 mRNA Translation: BAF82786.1
AK291583 mRNA Translation: BAF84272.1
AK292202 mRNA Translation: BAF84891.1
AK057168 mRNA Translation: BAG51874.1
AL031847 Genomic DNA No translation available.
AL031848 Genomic DNA No translation available.
CH471130 Genomic DNA Translation: EAW71528.1
CH471130 Genomic DNA Translation: EAW71529.1
CH471130 Genomic DNA Translation: EAW71530.1
BC017365 mRNA Translation: AAH17365.2 Different initiation.
CCDSiCCDS30573.1 [O00154-7]
CCDS65.1 [O00154-1]
CCDS66.1 [O00154-5]
CCDS67.1 [O00154-6]
PIRiJC7161
RefSeqiNP_009205.3, NM_007274.3 [O00154-7]
NP_863654.1, NM_181864.2 [O00154-1]
NP_863655.1, NM_181865.2 [O00154-5]
NP_863656.1, NM_181866.2 [O00154-6]
UniGeneiHs.126137

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2QQ2X-ray2.80A/B/C/D/E/F/G/H/I/J/K/L209-378[»]
ProteinModelPortaliO00154
SMRiO00154
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116460, 42 interactors
IntActiO00154, 29 interactors
MINTiO00154
STRINGi9606.ENSP00000367086

PTM databases

iPTMnetiO00154
PhosphoSitePlusiO00154
SwissPalmiO00154

Polymorphism and mutation databases

BioMutaiACOT7

2D gel databases

UCD-2DPAGEiO00154

Proteomic databases

EPDiO00154
jPOSTiO00154
MaxQBiO00154
PaxDbiO00154
PeptideAtlasiO00154
PRIDEiO00154
ProteomicsDBi47737
47738 [O00154-2]
47739 [O00154-3]
47740 [O00154-4]
47741 [O00154-5]
47742 [O00154-6]
TopDownProteomicsiO00154-1 [O00154-1]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		11332
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361521; ENSP00000354615; ENSG00000097021 [O00154-7]
ENST00000377842; ENSP00000367073; ENSG00000097021 [O00154-6]
ENST00000377845; ENSP00000367076; ENSG00000097021 [O00154-5]
ENST00000377855; ENSP00000367086; ENSG00000097021 [O00154-1]
ENST00000377860; ENSP00000367091; ENSG00000097021 [O00154-3]
ENST00000418124; ENSP00000402532; ENSG00000097021 [O00154-2]
ENST00000545482; ENSP00000439218; ENSG00000097021 [O00154-7]
ENST00000608083; ENSP00000476610; ENSG00000097021 [O00154-4]
GeneIDi11332
KEGGihsa:11332
UCSCiuc001amq.4 human [O00154-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		11332
DisGeNETi11332
EuPathDBiHostDB:ENSG00000097021.19

GeneCards: human genes, protein and diseases

More...GeneCardsi		ACOT7
HGNCiHGNC:24157 ACOT7
HPAiHPA025735
HPA025762
MIMi602587 gene
neXtProtiNX_O00154
OpenTargetsiENSG00000097021
PharmGKBiPA142672655

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2763 Eukaryota
COG1607 LUCA
GeneTreeiENSGT00940000155229
HOGENOMiHOG000007663
HOVERGENiHBG036928
InParanoidiO00154
KOiK17360
OMAiPTDVNWG
OrthoDBi1069806at2759
PhylomeDBiO00154
TreeFamiTF329579

Enzyme and pathway databases

BRENDAi3.1.2.2 2681
3.1.2.20 2681
ReactomeiR-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation
SABIO-RKiO00154

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ACOT7 human
EvolutionaryTraceiO00154

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ACOT7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		11332

Protein Ontology

More...PROi		PR:O00154

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000097021 Expressed in 199 organ(s), highest expression level in anterior cingulate cortex
ExpressionAtlasiO00154 baseline and differential
GenevisibleiO00154 HS

Family and domain databases

InterProiView protein in InterPro
IPR040170 Cytosol_ACT
IPR033120 HOTDOG_ACOT
IPR029069 HotDog_dom_sf
IPR006683 Thioestr_dom
PANTHERiPTHR11049 PTHR11049, 1 hit
PfamiView protein in Pfam
PF03061 4HBT, 2 hits
SUPFAMiSSF54637 SSF54637, 2 hits
PROSITEiView protein in PROSITE
PS51770 HOTDOG_ACOT, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBACH_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00154
Secondary accession number(s): A8K0K7
, A8K232, A8K6B8, A8K837, B3KQ12, O43703, Q53Y78, Q5JYL2, Q5JYL3, Q5JYL4, Q5JYL5, Q5JYL6, Q5TGR4, Q9UJM9, Q9Y539, Q9Y540
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 12, 2003
Last modified: January 16, 2019
This is version 177 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again