Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O00141 (SGK1_HUMAN)

Entry version 207 (02 Jun 2021)
Sequence version 2 (07 Mar 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Serine/threonine-protein kinase Sgk1

Gene

SGK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cellular enzymes, transcription factors, neuronal excitability, cell growth, proliferation, survival, migration and apoptosis. Plays an important role in cellular stress response. Contributes to regulation of renal Na+ retention, renal K+ elimination, salt appetite, gastric acid secretion, intestinal Na+/H+ exchange and nutrient transport, insulin-dependent salt sensitivity of blood pressure, salt sensitivity of peripheral glucose uptake, cardiac repolarization and memory consolidation. Up-regulates Na+ channels: SCNN1A/ENAC, SCN5A and ASIC1/ACCN2, K+ channels: KCNJ1/ROMK1, KCNA1-5, KCNQ1-5 and KCNE1, epithelial Ca2+ channels: TRPV5 and TRPV6, chloride channels: BSND, CLCN2 and CFTR, glutamate transporters: SLC1A3/EAAT1, SLC1A2 /EAAT2, SLC1A1/EAAT3, SLC1A6/EAAT4 and SLC1A7/EAAT5, amino acid transporters: SLC1A5/ASCT2, SLC38A1/SN1 and SLC6A19, creatine transporter: SLC6A8, Na+/dicarboxylate cotransporter: SLC13A2/NADC1, Na+-dependent phosphate cotransporter: SLC34A2/NAPI-2B, glutamate receptor: GRIK2/GLUR6. Up-regulates carriers: SLC9A3/NHE3, SLC12A1/NKCC2, SLC12A3/NCC, SLC5A3/SMIT, SLC2A1/GLUT1, SLC5A1/SGLT1 and SLC15A2/PEPT2. Regulates enzymes: GSK3A/B, PMM2 and Na+/K+ ATPase, and transcription factors: CTNNB1 and nuclear factor NF-kappa-B. Stimulates sodium transport into epithelial cells by enhancing the stability and expression of SCNN1A/ENAC. This is achieved by phosphorylating the NEDD4L ubiquitin E3 ligase, promoting its interaction with 14-3-3 proteins, thereby preventing it from binding to SCNN1A/ENAC and targeting it for degradation. Regulates store-operated Ca(+2) entry (SOCE) by stimulating ORAI1 and STIM1. Regulates KCNJ1/ROMK1 directly via its phosphorylation or indirectly via increased interaction with SLC9A3R2/NHERF2. Phosphorylates MDM2 and activates MDM2-dependent ubiquitination of p53/TP53. Phosphorylates MAPT/TAU and mediates microtubule depolymerization and neurite formation in hippocampal neurons. Phosphorylates SLC2A4/GLUT4 and up-regulates its activity. Phosphorylates APBB1/FE65 and promotes its localization to the nucleus. Phosphorylates MAPK1/ERK2 and activates it by enhancing its interaction with MAP2K1/MEK1 and MAP2K2/MEK2. Phosphorylates FBXW7 and plays an inhibitory role in the NOTCH1 signaling. Phosphorylates FOXO1 resulting in its relocalization from the nucleus to the cytoplasm. Phosphorylates FOXO3, promoting its exit from the nucleus and interference with FOXO3-dependent transcription. Phosphorylates BRAF and MAP3K3/MEKK3 and inhibits their activity. Phosphorylates SLC9A3/NHE3 in response to dexamethasone, resulting in its activation and increased localization at the cell membrane. Phosphorylates CREB1. Necessary for vascular remodeling during angiogenesis. Sustained high levels and activity may contribute to conditions such as hypertension and diabetic nephropathy. Isoform 2 exhibited a greater effect on cell plasma membrane expression of SCNN1A/ENAC and Na+ transport than isoform 1.

32 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Two specific sites, one in the kinase domain (Thr-256) and the other in the C-terminal regulatory region (Ser-422), need to be phosphorylated for its full activation. Phosphorylation at Ser-397 and Ser-401 are also essential for its activity. Activated by WNK1, WNK2, WNK3 and WNK4.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei127ATP1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei222Proton acceptor1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi104 – 112ATP9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processApoptosis, Stress response
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.7.11.1, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O00141

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-2672351, Stimuli-sensing channels
R-HSA-6804757, Regulation of TP53 Degradation
R-HSA-8986944, Transcriptional Regulation by MECP2
R-HSA-9031628, NGF-stimulated transcription

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O00141

SIGNOR Signaling Network Open Resource

More...SIGNORi		O00141

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase Sgk1 (EC:2.7.11.1)
Alternative name(s):
Serum/glucocorticoid-regulated kinase 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SGK1
Synonyms:SGK
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:10810, SGK1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602958, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O00141

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000118515.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Mitochondrion, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi127K → M: Abolishes enzymatic activity. 3 Publications1
Mutagenesisi256T → A: Low activity. 1 Publication1
Mutagenesisi256T → D: Low activity. 1 Publication1
Mutagenesisi256T → E: Low activity. 1 Publication1
Mutagenesisi298Y → A: Abolishes interaction with NEDD4 and NEDD4L. 1 Publication1
Mutagenesisi422S → A: Low activity. 4 Publications1
Mutagenesisi422S → D: 10-fold activation. 4 Publications1

Organism-specific databases

DisGeNET

More...DisGeNETi		6446

Open Targets

More...OpenTargetsi		ENSG00000118515

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162403013

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O00141, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2343

Drug and drug target database

More...DrugBanki		DB08191, 4-(5-phenyl-1H-pyrrolo[2,3-b]pyridin-3-yl)benzoic acid
DB07837, [4-(5-naphthalen-2-yl-1H-pyrrolo[2,3-b]pyridin-3-yl)phenyl]acetic acid
DB03247, Flavin mononucleotide

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		1534

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SGK1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000866421 – 431Serine/threonine-protein kinase Sgk1Add BLAST431

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei74PhosphoserineCombined sources1
Modified residuei78Phosphoserine; by MAPK71 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi193Interchain (with C-258)1 Publication
Modified residuei256Phosphothreonine; by PDPK11 Publication1
Disulfide bondi258Interchain (with C-193)1 Publication
Modified residuei369Phosphothreonine; by PKA1 Publication1
Modified residuei397PhosphoserineCombined sources1 Publication1
Modified residuei401PhosphoserineCombined sources1 Publication1
Modified residuei422Phosphoserine3 Publications1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Regulated by phosphorylation. Activated by phosphorylation on Ser-422 by mTORC2, transforming it into a substrate for PDPK1 which phosphorylates it on Thr-256. Phosphorylation on Ser-397 and Ser-401 are also essential for its activity. Phosphorylation on Ser-78 by MAPK7 is required for growth factor-induced cell cycle progression.6 Publications
Ubiquitinated by NEDD4L; which promotes proteasomal degradation. Ubiquitinated by SYVN1 at the endoplasmic reticulum; which promotes rapid proteasomal degradation and maintains a high turnover rate in resting cells. Isoform 2 shows enhanced stability.1 Publication

Keywords - PTMi

Disulfide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O00141

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O00141

MaxQB - The MaxQuant DataBase

More...MaxQBi		O00141

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O00141

PeptideAtlas

More...PeptideAtlasi		O00141

PRoteomics IDEntifications database

More...PRIDEi		O00141

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		47726 [O00141-1]
47727 [O00141-2]
47728 [O00141-3]
47729 [O00141-4]
47730 [O00141-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O00141

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O00141

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in most tissues with highest levels in the pancreas, followed by placenta, kidney and lung. Isoform 2 is strongly expressed in brain and pancreas, weaker in heart, placenta, lung, liver and skeletal muscle.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Induced by a very large spectrum of stimuli distinct from glucocorticoids and serum. These include aldosterone, cell shrinkage, cell swelling, TGF-beta, ischemic injury of the brain, neuronal excitotoxicity memory consolidation, chronic viral hepatitis, DNA-damaging agents, vitamin D3 psychophysiological stress, iron, glucose, EDN1, CSF2, fibroblast growth factor, platelet-derived growth factor, phorbolesters, follicle-stimulating hormone, sorbitol, heat shock, oxidative stress, UV irradiation, and p53/TP53. Many of these stimuli are highly cell-specific, as is the case, for example for aldosterone, which has been found to stimulate its expression only in cells derived from aldosterone-responsive epithelia. Isoform 2 is not induced by glucocorticoids but by excessive extracellular glucose and by TGFB1, in cultured cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000118515, Expressed in female gonad and 248 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O00141, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O00141, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000118515, Tissue enhanced (parathyroid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked.

Forms a trimeric complex with FBXW7 and NOTCH1.

Interacts with MAPK3/ERK1, MAPK1/ERK2, MAP2K1/MEK1, MAP2K2/MEK2, NEDD4, NEDD4L, MAPT/TAU, MAPK7, CREB1, SLC9A3R2/NHERF2 and KCNJ1/ROMK1. Associates with the mammalian target of rapamycin complex 2 (mTORC2) via an interaction with MAPKAP1/SIN1.

8 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		112344, 67 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O00141

Database of interacting proteins

More...DIPi		DIP-42464N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		O00141

Protein interaction database and analysis system

More...IntActi		O00141, 20 interactors

Molecular INTeraction database

More...MINTi		O00141

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000356832

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		O00141

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O00141, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1431
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O00141

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O00141

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini98 – 355Protein kinasePROSITE-ProRule annotationAdd BLAST258
Domaini356 – 431AGC-kinase C-terminalPROSITE-ProRule annotationAdd BLAST76

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 60Necessary for localization to the mitochondriaAdd BLAST60
Regioni66 – 92DisorderedSequence analysisAdd BLAST27

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi131 – 141Nuclear localization signal1 PublicationAdd BLAST11

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Isoform 2 subcellular localization at the cell membrane and resistance to proteasomal degradation is mediated by the sequences within the first 120 amino acids.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0598, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155726

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_000288_63_5_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O00141

Identification of Orthologs from Complete Genome Data

More...OMAi		LKPINWR

Database of Orthologous Groups

More...OrthoDBi		614710at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O00141

TreeFam database of animal gene trees

More...TreeFami		TF320906

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000961, AGC-kinase_C
IPR011009, Kinase-like_dom_sf
IPR017892, Pkinase_C
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR008271, Ser/Thr_kinase_AS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00069, Pkinase, 1 hit
PF00433, Pkinase_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00133, S_TK_X, 1 hit
SM00220, S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51285, AGC_KINASE_CTER, 1 hit
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O00141-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTVKTEAAKG TLTYSRMRGM VAILIAFMKQ RRMGLNDFIQ KIANNSYACK 
        60         70         80         90        100
HPEVQSILKI SQPQEPELMN ANPSPPPSPS QQINLGPSSN PHAKPSDFHF 
       110        120        130        140        150
LKVIGKGSFG KVLLARHKAE EVFYAVKVLQ KKAILKKKEE KHIMSERNVL 
       160        170        180        190        200
LKNVKHPFLV GLHFSFQTAD KLYFVLDYIN GGELFYHLQR ERCFLEPRAR 
       210        220        230        240        250
FYAAEIASAL GYLHSLNIVY RDLKPENILL DSQGHIVLTD FGLCKENIEH 
       260        270        280        290        300
NSTTSTFCGT PEYLAPEVLH KQPYDRTVDW WCLGAVLYEM LYGLPPFYSR 
       310        320        330        340        350
NTAEMYDNIL NKPLQLKPNI TNSARHLLEG LLQKDRTKRL GAKDDFMEIK 
       360        370        380        390        400
SHVFFSLINW DDLINKKITP PFNPNVSGPN DLRHFDPEFT EEPVPNSIGK 
       410        420        430 
SPDSVLVTAS VKEAAEAFLG FSYAPPTDSF L
Length:431
Mass (Da):48,942
Last modified:March 7, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF3697C63AB1F499D
GO
Isoform 2 (identifier: O00141-2) [UniParc]FASTAAdd to basket
Also known as: Sgk1.1, Sgk1_v2

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MTVKTEAAKGTLTYSRMRGMVAILI → MVNKDMNGFP...PRTFWTNDDP

Note: Produced by alternative promoter usage.Curated
Show »
Length:526
Mass (Da):59,904
Checksum:i8CE1E9DFB949D5A5
GO
Isoform 3 (identifier: O00141-3) [UniParc]FASTAAdd to basket
Also known as: Sgk1.2

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MTVKTEAAKGTLTYSRMRGMVAILI → MGEMQGALARARLESLLRPRHKKRAEAQKRSESFLLSGL

Note: Produced by alternative promoter usage.Curated
Show »
Length:445
Mass (Da):50,623
Checksum:iDC7076E1F43BCBAB
GO
Isoform 4 (identifier: O00141-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MTVKTEAAKGTLTYSRMRGMVAILI → MKPSKRFFISPPSST

Note: Produced by alternative splicing of isoform 1.Curated
Show »
Length:421
Mass (Da):47,910
Checksum:i6BDCD1FA7D9AFD0E
GO
Isoform 5 (identifier: O00141-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MTVKTEAAKGTLTYSRMRGMVAILI → MSSQSSSLSE...KEEAIKPPLK

Note: Produced by alternative promoter usage.Curated
Show »
Length:459
Mass (Da):52,119
Checksum:i1B108E7CF17935E5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PR89E9PR89_HUMAN
Serine/threonine-protein kinase Sgk...
SGK1
387Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJN2E9PJN2_HUMAN
Serine/threonine-protein kinase Sgk...
SGK1
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q7Z3I4Q7Z3I4_HUMAN
Serine/threonine-protein kinase Sgk...
SGK1 DKFZp686H1615
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PP33E9PP33_HUMAN
Serine/threonine-protein kinase Sgk...
SGK1
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCJ3H0YCJ3_HUMAN
Serine/threonine-protein kinase Sgk...
SGK1
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti62Q → E in CAR58097 (Ref. 4) Curated1
Sequence conflicti152K → R in CAR58096 (Ref. 4) Curated1
Sequence conflicti196E → G in CAR58095 (Ref. 4) Curated1
Sequence conflicti228I → V in BAH12848 (PubMed:14702039).Curated1
Sequence conflicti371P → R in CAR58097 (Ref. 4) Curated1
Sequence conflicti381D → E in CAA71138 (PubMed:9114008).Curated1
Sequence conflicti381D → E in CAA04146 (PubMed:9722955).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_041071219V → I1 PublicationCorresponds to variant dbSNP:rs34133418Ensembl.1
Natural variantiVAR_041072342A → V1 PublicationCorresponds to variant dbSNP:rs55932330Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0377841 – 25MTVKT…VAILI → MVNKDMNGFPVKKCSAFQFF KKRVRRWIKSPMVSVDKHQS PSLKYTGSSMVHIPPGEPDF ESSLCQTCLGEHAFQRGVLP QENESCSWETQSGCEVREPC NHANILTKPDPRTFWTNDDP in isoform 2. 3 PublicationsAdd BLAST25
Alternative sequenceiVSP_0377851 – 25MTVKT…VAILI → MGEMQGALARARLESLLRPR HKKRAEAQKRSESFLLSGL in isoform 3. 2 PublicationsAdd BLAST25
Alternative sequenceiVSP_0377861 – 25MTVKT…VAILI → MKPSKRFFISPPSST in isoform 4. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_0377871 – 25MTVKT…VAILI → MSSQSSSLSEACSREAYSSH NWALPPASRSNPQPAYPWAT RRMKEEAIKPPLK in isoform 5. 1 PublicationAdd BLAST25

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y10032 mRNA Translation: CAA71138.1
AJ000512 Genomic DNA Translation: CAA04146.1
EU518415 mRNA Translation: ACD35864.1
FM205707 mRNA Translation: CAR58095.1
FM205708 mRNA Translation: CAR58096.1
FM205709 mRNA Translation: CAR58097.1
FM205710 mRNA Translation: CAR58098.1
AF153609 mRNA Translation: AAD41091.1
AK055077 mRNA Translation: BAG51463.1
AK298688 mRNA Translation: BAH12848.1
AL355881 Genomic DNA No translation available.
AL135839 Genomic DNA No translation available.
Z84486 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47991.1
CH471051 Genomic DNA Translation: EAW47992.1
CH471051 Genomic DNA Translation: EAW47993.1
BC001263 mRNA Translation: AAH01263.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS47476.1 [O00141-2]
CCDS47477.1 [O00141-5]
CCDS47478.1 [O00141-3]
CCDS5170.1 [O00141-1]

NCBI Reference Sequences

More...RefSeqi		NP_001137148.1, NM_001143676.1 [O00141-2]
NP_001137149.1, NM_001143677.1 [O00141-5]
NP_001137150.1, NM_001143678.1 [O00141-3]
NP_001278924.1, NM_001291995.1
NP_005618.2, NM_005627.3 [O00141-1]
XP_011534373.1, XM_011536071.1 [O00141-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000237305; ENSP00000237305; ENSG00000118515 [O00141-1]
ENST00000367857; ENSP00000356831; ENSG00000118515 [O00141-4]
ENST00000367858; ENSP00000356832; ENSG00000118515 [O00141-2]
ENST00000413996; ENSP00000396242; ENSG00000118515 [O00141-3]
ENST00000528577; ENSP00000434450; ENSG00000118515 [O00141-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		6446

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:6446

UCSC genome browser

More...UCSCi		uc003qen.5, human [O00141-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y10032 mRNA Translation: CAA71138.1
AJ000512 Genomic DNA Translation: CAA04146.1
EU518415 mRNA Translation: ACD35864.1
FM205707 mRNA Translation: CAR58095.1
FM205708 mRNA Translation: CAR58096.1
FM205709 mRNA Translation: CAR58097.1
FM205710 mRNA Translation: CAR58098.1
AF153609 mRNA Translation: AAD41091.1
AK055077 mRNA Translation: BAG51463.1
AK298688 mRNA Translation: BAH12848.1
AL355881 Genomic DNA No translation available.
AL135839 Genomic DNA No translation available.
Z84486 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47991.1
CH471051 Genomic DNA Translation: EAW47992.1
CH471051 Genomic DNA Translation: EAW47993.1
BC001263 mRNA Translation: AAH01263.1
CCDSiCCDS47476.1 [O00141-2]
CCDS47477.1 [O00141-5]
CCDS47478.1 [O00141-3]
CCDS5170.1 [O00141-1]
RefSeqiNP_001137148.1, NM_001143676.1 [O00141-2]
NP_001137149.1, NM_001143677.1 [O00141-5]
NP_001137150.1, NM_001143678.1 [O00141-3]
NP_001278924.1, NM_001291995.1
NP_005618.2, NM_005627.3 [O00141-1]
XP_011534373.1, XM_011536071.1 [O00141-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2R5TX-ray1.90A60-431[»]
3HDMX-ray2.60A60-431[»]
3HDNX-ray3.10A60-431[»]
SMRiO00141
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112344, 67 interactors
CORUMiO00141
DIPiDIP-42464N
ELMiO00141
IntActiO00141, 20 interactors
MINTiO00141
STRINGi9606.ENSP00000356832

Chemistry databases

BindingDBiO00141
ChEMBLiCHEMBL2343
DrugBankiDB08191, 4-(5-phenyl-1H-pyrrolo[2,3-b]pyridin-3-yl)benzoic acid
DB07837, [4-(5-naphthalen-2-yl-1H-pyrrolo[2,3-b]pyridin-3-yl)phenyl]acetic acid
DB03247, Flavin mononucleotide
GuidetoPHARMACOLOGYi1534

PTM databases

iPTMnetiO00141
PhosphoSitePlusiO00141

Genetic variation databases

BioMutaiSGK1

Proteomic databases

jPOSTiO00141
MassIVEiO00141
MaxQBiO00141
PaxDbiO00141
PeptideAtlasiO00141
PRIDEiO00141
ProteomicsDBi47726 [O00141-1]
47727 [O00141-2]
47728 [O00141-3]
47729 [O00141-4]
47730 [O00141-5]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		O00141, 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...Antibodypediai		19734, 894 antibodies

The DNASU plasmid repository

More...DNASUi		6446

Genome annotation databases

EnsembliENST00000237305; ENSP00000237305; ENSG00000118515 [O00141-1]
ENST00000367857; ENSP00000356831; ENSG00000118515 [O00141-4]
ENST00000367858; ENSP00000356832; ENSG00000118515 [O00141-2]
ENST00000413996; ENSP00000396242; ENSG00000118515 [O00141-3]
ENST00000528577; ENSP00000434450; ENSG00000118515 [O00141-5]
GeneIDi6446
KEGGihsa:6446
UCSCiuc003qen.5, human [O00141-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		6446
DisGeNETi6446

GeneCards: human genes, protein and diseases

More...GeneCardsi		SGK1
HGNCiHGNC:10810, SGK1
HPAiENSG00000118515, Tissue enhanced (parathyroid)
MIMi602958, gene
neXtProtiNX_O00141
OpenTargetsiENSG00000118515
PharmGKBiPA162403013
VEuPathDBiHostDB:ENSG00000118515.11

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0598, Eukaryota
GeneTreeiENSGT00940000155726
HOGENOMiCLU_000288_63_5_1
InParanoidiO00141
OMAiLKPINWR
OrthoDBi614710at2759
PhylomeDBiO00141
TreeFamiTF320906

Enzyme and pathway databases

BRENDAi2.7.11.1, 2681
PathwayCommonsiO00141
ReactomeiR-HSA-2672351, Stimuli-sensing channels
R-HSA-6804757, Regulation of TP53 Degradation
R-HSA-8986944, Transcriptional Regulation by MECP2
R-HSA-9031628, NGF-stimulated transcription
SignaLinkiO00141
SIGNORiO00141

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		6446, 11 hits in 1033 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SGK1, human
EvolutionaryTraceiO00141

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SGK

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		6446
PharosiO00141, Tchem

Protein Ontology

More...PROi		PR:O00141
RNActiO00141, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000118515, Expressed in female gonad and 248 other tissues
ExpressionAtlasiO00141, baseline and differential
GenevisibleiO00141, HS

Family and domain databases

InterProiView protein in InterPro
IPR000961, AGC-kinase_C
IPR011009, Kinase-like_dom_sf
IPR017892, Pkinase_C
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR008271, Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069, Pkinase, 1 hit
PF00433, Pkinase_C, 1 hit
SMARTiView protein in SMART
SM00133, S_TK_X, 1 hit
SM00220, S_TKc, 1 hit
SUPFAMiSSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS51285, AGC_KINASE_CTER, 1 hit
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSGK1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00141
Secondary accession number(s): B7UUP7
, B7UUP8, B7UUP9, B7Z5B2, E1P583, Q5TCN2, Q5TCN3, Q5TCN4, Q5VY65, Q9UN56
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: March 7, 2006
Last modified: June 2, 2021
This is version 207 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again