Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF2A

Gene

KIF2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity.3 Publications

Miscellaneous

HeLa cells lacking KIF2A show asymmetric or monopolar mitotic spindles. Osteosarcoma cells (U2OS) lacking KIF2A or KIF2B show disorganised or monopolar mitotic spindles.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi313 – 320ATP8

GO - Molecular functioni

  • ATPase activity Source: GO_Central
  • ATP binding Source: UniProtKB-KW
  • microtubule binding Source: ARUK-UCL
  • microtubule motor activity Source: GO_Central
  • motor activity Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, Motor protein
Biological processCell cycle, Cell division, Differentiation, Mitosis, Neurogenesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2132295 MHC class II antigen presentation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-68877 Mitotic Prometaphase
R-HSA-983189 Kinesins

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF2A
Alternative name(s):
Kinesin-2
Short name:
hK2
Gene namesi
Name:KIF2A
Synonyms:KIF2, KNS2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000068796.16
HGNCiHGNC:6318 KIF2A
MIMi602591 gene
neXtProtiNX_O00139

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Involvement in diseasei

Cortical dysplasia, complex, with other brain malformations 3 (CDCBM3)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder of aberrant neuronal migration and disturbed axonal guidance. Clinical features include early-onset epilepsy, and various malformations of cortical development such as agyria, posterior or frontal pachygyria, subcortical band heterotopia, and thin corpus callosum.
See also OMIM:615411
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_070575317S → N in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant dbSNP:rs587777034EnsemblClinVar.1
Natural variantiVAR_070576321H → D in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant dbSNP:rs587777033EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi3796
MalaCardsiKIF2A
MIMi615411 phenotype
OpenTargetsiENSG00000068796
PharmGKBiPA162393356

Polymorphism and mutation databases

BioMutaiKIF2A

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001254141 – 706Kinesin-like protein KIF2AAdd BLAST706

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei75PhosphoserineCombined sources1
Modified residuei78PhosphothreonineCombined sources1
Modified residuei97PhosphothreonineCombined sources1
Modified residuei100PhosphoserineCombined sources1
Modified residuei102N6-acetyllysineBy similarity1
Modified residuei135PhosphoserineCombined sources1
Modified residuei140PhosphoserineCombined sources1
Isoform 4 (identifier: O00139-4)
Modified residuei556Phosphoserine By similarityBy similarity1
Modified residuei573Phosphoserine By similarityBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO00139
PeptideAtlasiO00139
PRIDEiO00139
ProteomicsDBi47722
47723 [O00139-1]
47724 [O00139-2]
47725 [O00139-4]

PTM databases

iPTMnetiO00139
PhosphoSitePlusiO00139

Expressioni

Gene expression databases

BgeeiENSG00000068796 Expressed in 219 organ(s), highest expression level in corpus callosum
CleanExiHS_KIF2A
ExpressionAtlasiO00139 baseline and differential
GenevisibleiO00139 HS

Organism-specific databases

HPAiHPA004715
HPA004716

Interactioni

Subunit structurei

Interacts with AURKA, PSRC1 and PLK1.3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi109997, 67 interactors
DIPiDIP-56112N
IntActiO00139, 60 interactors
MINTiO00139

Structurei

Secondary structure

1706
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO00139
SMRiO00139
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO00139

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini223 – 553Kinesin motorPROSITE-ProRule annotationAdd BLAST331

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 217GlobularSequence analysisAdd BLAST217

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili660 – 699Sequence analysisAdd BLAST40

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. MCAK/KIF2 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

GeneTreeiENSGT00930000150912
HOGENOMiHOG000231329
HOVERGENiHBG003875
InParanoidiO00139
KOiK10393
OMAiITVEWYE
OrthoDBiEOG091G06V3
PhylomeDBiO00139
TreeFamiTF105222

Family and domain databases

Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: O00139-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATANFGKIQ IGIYVEIKRS DGRIHQAMVT SLNEDNESVT VEWIENGDTK
60 70 80 90 100
GKEIDLESIF SLNPDLVPDE EIEPSPETPP PPASSAKVNK IVKNRRTVAS
110 120 130 140 150
IKNDPPSRDN RVVGSARARP SQFPEQSSSA QQNGSVSDIS PVQAAKKEFG
160 170 180 190 200
PPSRRKSNCV KEVEKLQEKR EKRRLQQQEL REKRAQDVDA TNPNYEIMCM
210 220 230 240 250
IRDFRGSLDY RPLTTADPID EHRICVCVRK RPLNKKETQM KDLDVITIPS
260 270 280 290 300
KDVVMVHEPK QKVDLTRYLE NQTFRFDYAF DDSAPNEMVY RFTARPLVET
310 320 330 340 350
IFERGMATCF AYGQTGSGKT HTMGGDFSGK NQDCSKGIYA LAARDVFLML
360 370 380 390 400
KKPNYKKLEL QVYATFFEIY SGKVFDLLNR KTKLRVLEDG KQQVQVVGLQ
410 420 430 440 450
EREVKCVEDV LKLIDIGNSC RTSGQTSANA HSSRSHAVFQ IILRRKGKLH
460 470 480 490 500
GKFSLIDLAG NERGADTSSA DRQTRLEGAE INKSLLALKE CIRALGRNKP
510 520 530 540 550
HTPFRASKLT QVLRDSFIGE NSRTCMIATI SPGMASCENT LNTLRYANRV
560 570 580 590 600
KELTVDPTAA GDVRPIMHHP PNQIDDLETQ WGVGSSPQRD DLKLLCEQNE
610 620 630 640 650
EEVSPQLFTF HEAVSQMVEM EEQVVEDHRA VFQESIRWLE DEKALLEMTE
660 670 680 690 700
EVDYDVDSYA TQLEAILEQK IDILTELRDK VKSFRAALQE EEQASKQINP

KRPRAL
Length:706
Mass (Da):79,955
Last modified:October 2, 2007 - v3
Checksum:iA407D84B6BD04ACF
GO
Isoform 1 (identifier: O00139-1) [UniParc]FASTAAdd to basket
Also known as: HK2

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.

Show »
Length:679
Mass (Da):76,955
Checksum:iABB522C323822AF6
GO
Isoform 2 (identifier: O00139-2) [UniParc]FASTAAdd to basket
Also known as: HK2s

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.
     134-153: GSVSDISPVQAAKKEFGPPS → A

Show »
Length:660
Mass (Da):75,043
Checksum:i8975B0872C83FED9
GO
Isoform 4 (identifier: O00139-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     552-552: E → EFGISPSDIPFSQGSGSRPDLSPSYEYDDFSPSVTRVKE

Note: No experimental confirmation available.By similarity
Show »
Length:744
Mass (Da):84,089
Checksum:i9948FA52D473F3B0
GO
Isoform 5 (identifier: O00139-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MATANFGKIQIGIYVEIKRSD → M

Note: Gene prediction based on EST data.
Show »
Length:686
Mass (Da):77,749
Checksum:iA7845ECBC1EDA7D9
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6R9M0D6R9M0_HUMAN
Kinesin-like protein KIF2A
KIF2A
284Annotation score:
H0Y8H2H0Y8H2_HUMAN
Kinesin-like protein KIF2A
KIF2A
130Annotation score:
D6RD93D6RD93_HUMAN
Kinesin-like protein KIF2A
KIF2A
80Annotation score:

Sequence cautioni

The sequence AAP84320 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti143Q → H in AAP84320 (Ref. 7) Curated1
Sequence conflicti153S → SHLFFSA in AAP84320 (Ref. 7) Curated1
Sequence conflicti295R → K in CAA69621 (PubMed:9177777).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_070575317S → N in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant dbSNP:rs587777034EnsemblClinVar.1
Natural variantiVAR_070576321H → D in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant dbSNP:rs587777033EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0283741 – 27Missing in isoform 1 and isoform 2. 3 PublicationsAdd BLAST27
Alternative sequenceiVSP_0473731 – 21MATAN…IKRSD → M in isoform 5. CuratedAdd BLAST21
Alternative sequenceiVSP_028375134 – 153GSVSD…FGPPS → A in isoform 2. 2 PublicationsAdd BLAST20
Alternative sequenceiVSP_028376552E → EFGISPSDIPFSQGSGSRPD LSPSYEYDDFSPSVTRVKE in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08319 mRNA Translation: CAA69621.1
AK302270 mRNA Translation: BAG63616.1
EF560716 mRNA Translation: ABQ59026.1
EF560728 mRNA Translation: ABQ59038.1
AC016637 Genomic DNA No translation available.
AC034242 Genomic DNA No translation available.
AC114982 Genomic DNA No translation available.
CH471137 Genomic DNA Translation: EAW51388.1
CH471137 Genomic DNA Translation: EAW51390.1
BC031828 mRNA Translation: AAH31828.1
AY317140 mRNA Translation: AAP84320.1 Different initiation.
CCDSiCCDS3980.2 [O00139-3]
CCDS47216.1 [O00139-4]
CCDS58949.1 [O00139-5]
RefSeqiNP_001091981.1, NM_001098511.2 [O00139-4]
NP_001230881.1, NM_001243952.1 [O00139-5]
NP_004511.2, NM_004520.4 [O00139-3]
UniGeneiHs.558351

Genome annotation databases

EnsembliENST00000381103; ENSP00000370493; ENSG00000068796 [O00139-5]
ENST00000401507; ENSP00000385622; ENSG00000068796 [O00139-3]
ENST00000407818; ENSP00000385000; ENSG00000068796 [O00139-4]
ENST00000506857; ENSP00000423772; ENSG00000068796 [O00139-2]
GeneIDi3796
KEGGihsa:3796
UCSCiuc003jsx.5 human [O00139-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08319 mRNA Translation: CAA69621.1
AK302270 mRNA Translation: BAG63616.1
EF560716 mRNA Translation: ABQ59026.1
EF560728 mRNA Translation: ABQ59038.1
AC016637 Genomic DNA No translation available.
AC034242 Genomic DNA No translation available.
AC114982 Genomic DNA No translation available.
CH471137 Genomic DNA Translation: EAW51388.1
CH471137 Genomic DNA Translation: EAW51390.1
BC031828 mRNA Translation: AAH31828.1
AY317140 mRNA Translation: AAP84320.1 Different initiation.
CCDSiCCDS3980.2 [O00139-3]
CCDS47216.1 [O00139-4]
CCDS58949.1 [O00139-5]
RefSeqiNP_001091981.1, NM_001098511.2 [O00139-4]
NP_001230881.1, NM_001243952.1 [O00139-5]
NP_004511.2, NM_004520.4 [O00139-3]
UniGeneiHs.558351

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GRYX-ray2.35A153-553[»]
6BBNX-ray3.51E153-553[»]
ProteinModelPortaliO00139
SMRiO00139
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109997, 67 interactors
DIPiDIP-56112N
IntActiO00139, 60 interactors
MINTiO00139

PTM databases

iPTMnetiO00139
PhosphoSitePlusiO00139

Polymorphism and mutation databases

BioMutaiKIF2A

Proteomic databases

EPDiO00139
PeptideAtlasiO00139
PRIDEiO00139
ProteomicsDBi47722
47723 [O00139-1]
47724 [O00139-2]
47725 [O00139-4]

Protocols and materials databases

DNASUi3796
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381103; ENSP00000370493; ENSG00000068796 [O00139-5]
ENST00000401507; ENSP00000385622; ENSG00000068796 [O00139-3]
ENST00000407818; ENSP00000385000; ENSG00000068796 [O00139-4]
ENST00000506857; ENSP00000423772; ENSG00000068796 [O00139-2]
GeneIDi3796
KEGGihsa:3796
UCSCiuc003jsx.5 human [O00139-3]

Organism-specific databases

CTDi3796
DisGeNETi3796
EuPathDBiHostDB:ENSG00000068796.16
GeneCardsiKIF2A
H-InvDBiHIX0020778
HGNCiHGNC:6318 KIF2A
HPAiHPA004715
HPA004716
MalaCardsiKIF2A
MIMi602591 gene
615411 phenotype
neXtProtiNX_O00139
OpenTargetsiENSG00000068796
PharmGKBiPA162393356
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00930000150912
HOGENOMiHOG000231329
HOVERGENiHBG003875
InParanoidiO00139
KOiK10393
OMAiITVEWYE
OrthoDBiEOG091G06V3
PhylomeDBiO00139
TreeFamiTF105222

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2132295 MHC class II antigen presentation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-68877 Mitotic Prometaphase
R-HSA-983189 Kinesins

Miscellaneous databases

EvolutionaryTraceiO00139
GeneWikiiKIF2A
GenomeRNAii3796
PROiPR:O00139
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000068796 Expressed in 219 organ(s), highest expression level in corpus callosum
CleanExiHS_KIF2A
ExpressionAtlasiO00139 baseline and differential
GenevisibleiO00139 HS

Family and domain databases

Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiKIF2A_HUMAN
AccessioniPrimary (citable) accession number: O00139
Secondary accession number(s): A5YM42
, A5YM54, B4DY54, D3DW97, E9PB70, Q7Z5I3, Q8N5Q7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: October 2, 2007
Last modified: November 7, 2018
This is version 169 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again