Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O00139 (KIF2A_HUMAN)

Protein

Kinesin-like protein KIF2A

Gene

KIF2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity.3 Publications

Miscellaneous

HeLa cells lacking KIF2A show asymmetric or monopolar mitotic spindles. Osteosarcoma cells (U2OS) lacking KIF2A or KIF2B show disorganised or monopolar mitotic spindles.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi313 – 320ATP8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATPase activity Source: GO_Central
  • ATP binding Source: UniProtKB-KW
  • microtubule binding Source: ARUK-UCL
  • microtubule motor activity Source: GO_Central
  • motor activity Source: ProtInc
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Motor protein
Biological processCell cycle, Cell division, Differentiation, Mitosis, Neurogenesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2132295 MHC class II antigen presentation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-68877 Mitotic Prometaphase
R-HSA-983189 Kinesins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin-like protein KIF2A
Alternative name(s):
Kinesin-2
Short name:
hK2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KIF2A
Synonyms:KIF2, KNS2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000068796.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:6318 KIF2A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602591 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O00139

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Cortical dysplasia, complex, with other brain malformations 3 (CDCBM3)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder of aberrant neuronal migration and disturbed axonal guidance. Clinical features include early-onset epilepsy, and various malformations of cortical development such as agyria, posterior or frontal pachygyria, subcortical band heterotopia, and thin corpus callosum.
See also OMIM:615411
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_070575317S → N in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant dbSNP:rs587777034EnsemblClinVar.1
Natural variantiVAR_070576321H → D in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant dbSNP:rs587777033EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...DisGeNETi		3796

MalaCards human disease database

More...MalaCardsi		KIF2A
MIMi615411 phenotype

Open Targets

More...OpenTargetsi		ENSG00000068796

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162393356

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KIF2A

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001254141 – 706Kinesin-like protein KIF2AAdd BLAST706

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei75PhosphoserineCombined sources1
Modified residuei78PhosphothreonineCombined sources1
Modified residuei97PhosphothreonineCombined sources1
Modified residuei100PhosphoserineCombined sources1
Modified residuei102N6-acetyllysineBy similarity1
Modified residuei135PhosphoserineCombined sources1
Modified residuei140PhosphoserineCombined sources1
Isoform 4 (identifier: O00139-4)
Modified residuei556Phosphoserine By similarityBy similarity1
Modified residuei573Phosphoserine By similarityBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O00139

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O00139

PeptideAtlas

More...PeptideAtlasi		O00139

PRoteomics IDEntifications database

More...PRIDEi		O00139

ProteomicsDB human proteome resource

More...ProteomicsDBi		47722
47723 [O00139-1]
47724 [O00139-2]
47725 [O00139-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O00139

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O00139

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000068796 Expressed in 219 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...CleanExi		HS_KIF2A

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O00139 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O00139 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA004715
HPA004716

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with AURKA, PSRC1 and PLK1.3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		109997, 72 interactors

Database of interacting proteins

More...DIPi		DIP-56112N

Protein interaction database and analysis system

More...IntActi		O00139, 60 interactors

Molecular INTeraction database

More...MINTi		O00139

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1706
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GRYX-ray2.35A153-553[»]
6BBNX-ray3.51E153-553[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		O00139

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O00139

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O00139

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini223 – 553Kinesin motorPROSITE-ProRule annotationAdd BLAST331

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 217GlobularSequence analysisAdd BLAST217

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili660 – 699Sequence analysisAdd BLAST40

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. MCAK/KIF2 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155570

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000231329

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG003875

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O00139

KEGG Orthology (KO)

More...KOi		K10393

Identification of Orthologs from Complete Genome Data

More...OMAi		ITVEWYE

Database of Orthologous Groups

More...OrthoDBi		418348at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O00139

TreeFam database of animal gene trees

More...TreeFami		TF105222

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase

The PANTHER Classification System

More...PANTHERi		PTHR24115 PTHR24115, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00225 Kinesin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00380 KINESINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00129 KISc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: O00139-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATANFGKIQ IGIYVEIKRS DGRIHQAMVT SLNEDNESVT VEWIENGDTK 
        60         70         80         90        100
GKEIDLESIF SLNPDLVPDE EIEPSPETPP PPASSAKVNK IVKNRRTVAS 
       110        120        130        140        150
IKNDPPSRDN RVVGSARARP SQFPEQSSSA QQNGSVSDIS PVQAAKKEFG 
       160        170        180        190        200
PPSRRKSNCV KEVEKLQEKR EKRRLQQQEL REKRAQDVDA TNPNYEIMCM 
       210        220        230        240        250
IRDFRGSLDY RPLTTADPID EHRICVCVRK RPLNKKETQM KDLDVITIPS 
       260        270        280        290        300
KDVVMVHEPK QKVDLTRYLE NQTFRFDYAF DDSAPNEMVY RFTARPLVET 
       310        320        330        340        350
IFERGMATCF AYGQTGSGKT HTMGGDFSGK NQDCSKGIYA LAARDVFLML 
       360        370        380        390        400
KKPNYKKLEL QVYATFFEIY SGKVFDLLNR KTKLRVLEDG KQQVQVVGLQ 
       410        420        430        440        450
EREVKCVEDV LKLIDIGNSC RTSGQTSANA HSSRSHAVFQ IILRRKGKLH 
       460        470        480        490        500
GKFSLIDLAG NERGADTSSA DRQTRLEGAE INKSLLALKE CIRALGRNKP 
       510        520        530        540        550
HTPFRASKLT QVLRDSFIGE NSRTCMIATI SPGMASCENT LNTLRYANRV 
       560        570        580        590        600
KELTVDPTAA GDVRPIMHHP PNQIDDLETQ WGVGSSPQRD DLKLLCEQNE 
       610        620        630        640        650
EEVSPQLFTF HEAVSQMVEM EEQVVEDHRA VFQESIRWLE DEKALLEMTE 
       660        670        680        690        700
EVDYDVDSYA TQLEAILEQK IDILTELRDK VKSFRAALQE EEQASKQINP 

KRPRAL
Length:706
Mass (Da):79,955
Last modified:October 2, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA407D84B6BD04ACF
GO
Isoform 1 (identifier: O00139-1) [UniParc]FASTAAdd to basket
Also known as: HK2

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.

Show »
Length:679
Mass (Da):76,955
Checksum:iABB522C323822AF6
GO
Isoform 2 (identifier: O00139-2) [UniParc]FASTAAdd to basket
Also known as: HK2s

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.
     134-153: GSVSDISPVQAAKKEFGPPS → A

Show »
Length:660
Mass (Da):75,043
Checksum:i8975B0872C83FED9
GO
Isoform 4 (identifier: O00139-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     552-552: E → EFGISPSDIPFSQGSGSRPDLSPSYEYDDFSPSVTRVKE

Note: No experimental confirmation available.By similarity
Show »
Length:744
Mass (Da):84,089
Checksum:i9948FA52D473F3B0
GO
Isoform 5 (identifier: O00139-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MATANFGKIQIGIYVEIKRSD → M

Note: Gene prediction based on EST data.
Show »
Length:686
Mass (Da):77,749
Checksum:iA7845ECBC1EDA7D9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6R9M0D6R9M0_HUMAN
Kinesin-like protein KIF2A
KIF2A
284Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8H2H0Y8H2_HUMAN
Kinesin-like protein KIF2A
KIF2A
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RD93D6RD93_HUMAN
Kinesin-like protein KIF2A
KIF2A
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAP84320 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti143Q → H in AAP84320 (Ref. 7) Curated1
Sequence conflicti153S → SHLFFSA in AAP84320 (Ref. 7) Curated1
Sequence conflicti295R → K in CAA69621 (PubMed:9177777).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_070575317S → N in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant dbSNP:rs587777034EnsemblClinVar.1
Natural variantiVAR_070576321H → D in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant dbSNP:rs587777033EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0283741 – 27Missing in isoform 1 and isoform 2. 3 PublicationsAdd BLAST27
Alternative sequenceiVSP_0473731 – 21MATAN…IKRSD → M in isoform 5. CuratedAdd BLAST21
Alternative sequenceiVSP_028375134 – 153GSVSD…FGPPS → A in isoform 2. 2 PublicationsAdd BLAST20
Alternative sequenceiVSP_028376552E → EFGISPSDIPFSQGSGSRPD LSPSYEYDDFSPSVTRVKE in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y08319 mRNA Translation: CAA69621.1
AK302270 mRNA Translation: BAG63616.1
EF560716 mRNA Translation: ABQ59026.1
EF560728 mRNA Translation: ABQ59038.1
AC016637 Genomic DNA No translation available.
AC034242 Genomic DNA No translation available.
AC114982 Genomic DNA No translation available.
CH471137 Genomic DNA Translation: EAW51388.1
CH471137 Genomic DNA Translation: EAW51390.1
BC031828 mRNA Translation: AAH31828.1
AY317140 mRNA Translation: AAP84320.1 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3980.2 [O00139-3]
CCDS47216.1 [O00139-4]
CCDS58949.1 [O00139-5]

NCBI Reference Sequences

More...RefSeqi		NP_001091981.1, NM_001098511.2 [O00139-4]
NP_001230881.1, NM_001243952.1 [O00139-5]
NP_004511.2, NM_004520.4 [O00139-3]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.558351

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000381103; ENSP00000370493; ENSG00000068796 [O00139-5]
ENST00000401507; ENSP00000385622; ENSG00000068796 [O00139-3]
ENST00000407818; ENSP00000385000; ENSG00000068796 [O00139-4]
ENST00000506857; ENSP00000423772; ENSG00000068796 [O00139-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3796

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3796

UCSC genome browser

More...UCSCi		uc003jsx.5 human [O00139-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08319 mRNA Translation: CAA69621.1
AK302270 mRNA Translation: BAG63616.1
EF560716 mRNA Translation: ABQ59026.1
EF560728 mRNA Translation: ABQ59038.1
AC016637 Genomic DNA No translation available.
AC034242 Genomic DNA No translation available.
AC114982 Genomic DNA No translation available.
CH471137 Genomic DNA Translation: EAW51388.1
CH471137 Genomic DNA Translation: EAW51390.1
BC031828 mRNA Translation: AAH31828.1
AY317140 mRNA Translation: AAP84320.1 Different initiation.
CCDSiCCDS3980.2 [O00139-3]
CCDS47216.1 [O00139-4]
CCDS58949.1 [O00139-5]
RefSeqiNP_001091981.1, NM_001098511.2 [O00139-4]
NP_001230881.1, NM_001243952.1 [O00139-5]
NP_004511.2, NM_004520.4 [O00139-3]
UniGeneiHs.558351

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GRYX-ray2.35A153-553[»]
6BBNX-ray3.51E153-553[»]
ProteinModelPortaliO00139
SMRiO00139
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109997, 72 interactors
DIPiDIP-56112N
IntActiO00139, 60 interactors
MINTiO00139

PTM databases

iPTMnetiO00139
PhosphoSitePlusiO00139

Polymorphism and mutation databases

BioMutaiKIF2A

Proteomic databases

EPDiO00139
jPOSTiO00139
PeptideAtlasiO00139
PRIDEiO00139
ProteomicsDBi47722
47723 [O00139-1]
47724 [O00139-2]
47725 [O00139-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		3796
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381103; ENSP00000370493; ENSG00000068796 [O00139-5]
ENST00000401507; ENSP00000385622; ENSG00000068796 [O00139-3]
ENST00000407818; ENSP00000385000; ENSG00000068796 [O00139-4]
ENST00000506857; ENSP00000423772; ENSG00000068796 [O00139-2]
GeneIDi3796
KEGGihsa:3796
UCSCiuc003jsx.5 human [O00139-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3796
DisGeNETi3796
EuPathDBiHostDB:ENSG00000068796.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		KIF2A

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0020778
HGNCiHGNC:6318 KIF2A
HPAiHPA004715
HPA004716
MalaCardsiKIF2A
MIMi602591 gene
615411 phenotype
neXtProtiNX_O00139
OpenTargetsiENSG00000068796
PharmGKBiPA162393356

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000155570
HOGENOMiHOG000231329
HOVERGENiHBG003875
InParanoidiO00139
KOiK10393
OMAiITVEWYE
OrthoDBi418348at2759
PhylomeDBiO00139
TreeFamiTF105222

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2132295 MHC class II antigen presentation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-68877 Mitotic Prometaphase
R-HSA-983189 Kinesins

Miscellaneous databases

EvolutionaryTraceiO00139

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		KIF2A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3796

Protein Ontology

More...PROi		PR:O00139

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000068796 Expressed in 219 organ(s), highest expression level in corpus callosum
CleanExiHS_KIF2A
ExpressionAtlasiO00139 baseline and differential
GenevisibleiO00139 HS

Family and domain databases

Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKIF2A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O00139
Secondary accession number(s): A5YM42
, A5YM54, B4DY54, D3DW97, E9PB70, Q7Z5I3, Q8N5Q7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: October 2, 2007
Last modified: January 16, 2019
This is version 171 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again