Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Golgin subfamily A member 8M

Gene

GOLGA8M

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Protein inferred from homologyi <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • Golgi organization Source: GO_Central

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Golgin subfamily A member 8M
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GOLGA8MImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000188626.6

Human Gene Nomenclature Database

More...
HGNCi
HGNC:44404 GOLGA8M

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_H3BSY2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000188626

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004208601 – 632Golgin subfamily A member 8MAdd BLAST632

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
H3BSY2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
H3BSY2

PRoteomics IDEntifications database

More...
PRIDEi
H3BSY2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
42484

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
H3BSY2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
H3BSY2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000188626 Expressed in 79 organ(s), highest expression level in thyroid gland

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
H3BSY2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
H3BSY2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili86 – 154Sequence analysisAdd BLAST69
Coiled coili209 – 421Sequence analysisAdd BLAST213

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GOLGA8 family.Sequence analysis

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4725 Eukaryota
ENOG410ZIE4 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000062932

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000218631

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107946

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
H3BSY2

Identification of Orthologs from Complete Genome Data

More...
OMAi
XVEAKSQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0DDT

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024858 Golgin_A

The PANTHER Classification System

More...
PANTHERi
PTHR10881 PTHR10881, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15070 GOLGA2L5, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 11 Publication (identifier: H3BSY2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEETQHNKL AAAKKKLKEY WQKNSPRVPA GANRNRKTNG SIPQTATSGG
60 70 80 90 100
CQPPGDSATG FHREGPTSSA TLKDLESPCQ ERAVVLDSRS VEISQLKNTI
110 120 130 140 150
KSLKQQKKQV EHQLEEEKKA NNKKQKAKRV LEVQLQTLNI QKEELNTDLY
160 170 180 190 200
HMKRSLRYFE EKSKDLAVRL QHSLQRKGEL ESVLSDVMAT QKKKANQLSS
210 220 230 240 250
PSKAGTEWKL EQSMREEALL KVQLTQLKES FQQVQLERDE YSEHLKGERA
260 270 280 290 300
RWQQRMRKMS QEICTLKKEK QQDMRRVEKL ERSLSKLKNQ MAEPLPPEPP
310 320 330 340 350
AVPSEVELQH LRKELERVAG ELQAQVKNNQ RISLLNQRQE ERIREQEERL
360 370 380 390 400
RKQEERIQEQ HKSLQQLAKP QSVFEEPNNE NKSTLQLEQQ VKELQEKLGE
410 420 430 440 450
EHLEAASQQN QQLTAQLSLM ALPGEGHGGE HLDSEGEEAP QPMPSVPEDP
460 470 480 490 500
ESREAMSSFM DHLEEKADLS ELVKKQELRF IQYWQERCHQ KIHHLLSEPG
510 520 530 540 550
GRAKDAALGG GHHQAGAQGG DEGEAAGAAA DGIAAYSNYN NGHRKFLAAA
560 570 580 590 600
HNSADEPGPG APAPQELGAA DKHGDLCEVS LTSSAQGEAR EDPLLDKPTA
610 620 630
QPIVQDHQEH PGLGSNCCVP FFCWAWLPRR RR
Note: No experimental confirmation available.Curated
Length:632
Mass (Da):71,498
Last modified:April 18, 2012 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB2939F3C64BD3D60
GO
Isoform 21 Publication (identifier: H3BSY2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     82-116: RAVVLDSRSVEISQLKNTIKSLKQQKKQVEHQLEE → MGGPVLGHWWHSGGMSLAVPSLPPPGKSSVFLFLQ
     401-452: EHLEAASQQN...MPSVPEDPES → VKESETSTPS...RAVLFLASCL
     453-632: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:371
Mass (Da):42,924
Checksum:i299860FD4D794543
GO
Isoform 3 (identifier: H3BSY2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-262: Missing.
     401-452: EHLEAASQQN...MPSVPEDPES → VKESETSTPS...RAVLFLASCL
     453-632: Missing.

Note: No experimental confirmation available.
Show »
Length:293
Mass (Da):32,998
Checksum:i52998CAEB94F8BB5
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0447511 – 81Missing in isoform 2. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_04475282 – 116RAVVL…HQLEE → MGGPVLGHWWHSGGMSLAVP SLPPPGKSSVFLFLQ in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_053442104 – 262Missing in isoform 3. CuratedAdd BLAST159
Alternative sequenceiVSP_044753401 – 452EHLEA…EDPES → VKESETSTPSKKGWEAGSSL WGGEVPGQRQLPAWGLVTTA PPRAVLFLASCL in isoform 2 and isoform 3. CuratedAdd BLAST52
Alternative sequenceiVSP_044754453 – 632Missing in isoform 2 and isoform 3. CuratedAdd BLAST180

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC055876 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS61572.1 [H3BSY2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001269397.1, NM_001282468.1 [H3BSY2-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.562625
Hs.743947

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000563027; ENSP00000456927; ENSG00000188626 [H3BSY2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
653720

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:653720

UCSC genome browser

More...
UCSCi
uc021sgq.3 human [H3BSY2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC055876 Genomic DNA No translation available.
CCDSiCCDS61572.1 [H3BSY2-1]
RefSeqiNP_001269397.1, NM_001282468.1 [H3BSY2-1]
UniGeneiHs.562625
Hs.743947

3D structure databases

ProteinModelPortaliH3BSY2
SMRiH3BSY2
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiH3BSY2
PhosphoSitePlusiH3BSY2

Proteomic databases

MaxQBiH3BSY2
PaxDbiH3BSY2
PRIDEiH3BSY2
ProteomicsDBi42484

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000563027; ENSP00000456927; ENSG00000188626 [H3BSY2-1]
GeneIDi653720
KEGGihsa:653720
UCSCiuc021sgq.3 human [H3BSY2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
653720
EuPathDBiHostDB:ENSG00000188626.6

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GOLGA8M
HGNCiHGNC:44404 GOLGA8M
neXtProtiNX_H3BSY2
OpenTargetsiENSG00000188626

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4725 Eukaryota
ENOG410ZIE4 LUCA
GeneTreeiENSGT00530000062932
HOGENOMiHOG000218631
HOVERGENiHBG107946
InParanoidiH3BSY2
OMAiXVEAKSQ
OrthoDBiEOG091G0DDT

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
653720

Protein Ontology

More...
PROi
PR:H3BSY2

Gene expression databases

BgeeiENSG00000188626 Expressed in 79 organ(s), highest expression level in thyroid gland

Family and domain databases

InterProiView protein in InterPro
IPR024858 Golgin_A
PANTHERiPTHR10881 PTHR10881, 1 hit
PfamiView protein in Pfam
PF15070 GOLGA2L5, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGOG8M_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: H3BSY2
Secondary accession number(s): A6NCM5, F8WBD5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 9, 2013
Last sequence update: April 18, 2012
Last modified: November 7, 2018
This is version 49 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again