Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Golgin subfamily A member 8M

Gene

GOLGA8M

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Protein inferred from homologyi

Names & Taxonomyi

Protein namesi
Recommended name:
Golgin subfamily A member 8M
Gene namesi
Name:GOLGA8MImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000188626.6
HGNCiHGNC:44404 GOLGA8M
neXtProtiNX_H3BSY2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000188626

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004208601 – 632Golgin subfamily A member 8MAdd BLAST632

Proteomic databases

MaxQBiH3BSY2
PaxDbiH3BSY2
PRIDEiH3BSY2
ProteomicsDBi42484

PTM databases

iPTMnetiH3BSY2
PhosphoSitePlusiH3BSY2

Expressioni

Gene expression databases

BgeeiENSG00000188626

Structurei

3D structure databases

ProteinModelPortaliH3BSY2
SMRiH3BSY2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili86 – 154Sequence analysisAdd BLAST69
Coiled coili209 – 421Sequence analysisAdd BLAST213

Sequence similaritiesi

Belongs to the GOLGA8 family.Sequence analysis

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4725 Eukaryota
ENOG410ZIE4 LUCA
GeneTreeiENSGT00530000062932
HOGENOMiHOG000218631
InParanoidiH3BSY2
OMAiXVEAKSQ
OrthoDBiEOG091G0DDT

Family and domain databases

InterProiView protein in InterPro
IPR024858 Golgin_A
PfamiView protein in Pfam
PF15070 GOLGA2L5, 3 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: H3BSY2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEETQHNKL AAAKKKLKEY WQKNSPRVPA GANRNRKTNG SIPQTATSGG
60 70 80 90 100
CQPPGDSATG FHREGPTSSA TLKDLESPCQ ERAVVLDSRS VEISQLKNTI
110 120 130 140 150
KSLKQQKKQV EHQLEEEKKA NNKKQKAKRV LEVQLQTLNI QKEELNTDLY
160 170 180 190 200
HMKRSLRYFE EKSKDLAVRL QHSLQRKGEL ESVLSDVMAT QKKKANQLSS
210 220 230 240 250
PSKAGTEWKL EQSMREEALL KVQLTQLKES FQQVQLERDE YSEHLKGERA
260 270 280 290 300
RWQQRMRKMS QEICTLKKEK QQDMRRVEKL ERSLSKLKNQ MAEPLPPEPP
310 320 330 340 350
AVPSEVELQH LRKELERVAG ELQAQVKNNQ RISLLNQRQE ERIREQEERL
360 370 380 390 400
RKQEERIQEQ HKSLQQLAKP QSVFEEPNNE NKSTLQLEQQ VKELQEKLGE
410 420 430 440 450
EHLEAASQQN QQLTAQLSLM ALPGEGHGGE HLDSEGEEAP QPMPSVPEDP
460 470 480 490 500
ESREAMSSFM DHLEEKADLS ELVKKQELRF IQYWQERCHQ KIHHLLSEPG
510 520 530 540 550
GRAKDAALGG GHHQAGAQGG DEGEAAGAAA DGIAAYSNYN NGHRKFLAAA
560 570 580 590 600
HNSADEPGPG APAPQELGAA DKHGDLCEVS LTSSAQGEAR EDPLLDKPTA
610 620 630
QPIVQDHQEH PGLGSNCCVP FFCWAWLPRR RR
Note: No experimental confirmation available.Curated
Length:632
Mass (Da):71,498
Last modified:April 18, 2012 - v1
Checksum:iB2939F3C64BD3D60
GO
Isoform 21 Publication (identifier: H3BSY2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     82-116: RAVVLDSRSVEISQLKNTIKSLKQQKKQVEHQLEE → MGGPVLGHWWHSGGMSLAVPSLPPPGKSSVFLFLQ
     401-452: EHLEAASQQN...MPSVPEDPES → VKESETSTPS...RAVLFLASCL
     453-632: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:371
Mass (Da):42,924
Checksum:i299860FD4D794543
GO
Isoform 3 (identifier: H3BSY2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-262: Missing.
     401-452: EHLEAASQQN...MPSVPEDPES → VKESETSTPS...RAVLFLASCL
     453-632: Missing.

Note: No experimental confirmation available.
Show »
Length:293
Mass (Da):32,998
Checksum:i52998CAEB94F8BB5
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0447511 – 81Missing in isoform 2. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_04475282 – 116RAVVL…HQLEE → MGGPVLGHWWHSGGMSLAVP SLPPPGKSSVFLFLQ in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_053442104 – 262Missing in isoform 3. CuratedAdd BLAST159
Alternative sequenceiVSP_044753401 – 452EHLEA…EDPES → VKESETSTPSKKGWEAGSSL WGGEVPGQRQLPAWGLVTTA PPRAVLFLASCL in isoform 2 and isoform 3. CuratedAdd BLAST52
Alternative sequenceiVSP_044754453 – 632Missing in isoform 2 and isoform 3. CuratedAdd BLAST180

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC055876 Genomic DNA No translation available.
CCDSiCCDS61572.1 [H3BSY2-1]
RefSeqiNP_001269397.1, NM_001282468.1 [H3BSY2-1]
UniGeneiHs.562625
Hs.743947

Genome annotation databases

EnsembliENST00000563027; ENSP00000456927; ENSG00000188626 [H3BSY2-1]
GeneIDi653720
KEGGihsa:653720
UCSCiuc021sgq.3 human [H3BSY2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiGOG8M_HUMAN
AccessioniPrimary (citable) accession number: H3BSY2
Secondary accession number(s): A6NCM5, F8WBD5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 9, 2013
Last sequence update: April 18, 2012
Last modified: June 20, 2018
This is version 46 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health