Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 66 (16 Oct 2019)
Sequence version 1 (21 Mar 2012)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Contactin rig-6

Gene

rig-6

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable cell adhesion protein. Involved in patterning of the nervous system, playing a role in ALM and PLM touch receptor axon growth and VNC axon navigation. Also required for non-neuronal cell migration in the excretory canal, regulating excretory canal elongation and excretory cell morphogenesis.Curated1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion, Neurogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Contactin rig-61 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:rig-6Imported
ORF Names:C33F10.5Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegansImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome II

Organism-specific databases

WormBase

More...
WormBasei
C33F10.5a ; CE04138 ; WBGene00016354 ; rig-6
C33F10.5b ; CE25803 ; WBGene00016354 ; rig-6
C33F10.5c ; CE31679 ; WBGene00016354 ; rig-6
C33F10.5d ; CE37327 ; WBGene00016354 ; rig-6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1174 – 1194HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown results in truncated or shorter excretory canals, and also truncated ALM axons that fail to extend above the nerve ring, truncated PLM processes and abnormal VNC axon patterning.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_500356431520 – 1177Contactin rig-6CuratedAdd BLAST1158
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_00004372461178 – 1196Removed in mature formSequence analysisAdd BLAST19

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi100N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi169 ↔ 220PROSITE-ProRule annotation
Glycosylationi195N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Disulfide bondi263 ↔ 316PROSITE-ProRule annotation
Glycosylationi343N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Disulfide bondi372 ↔ 420PROSITE-ProRule annotation
Glycosylationi457N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Disulfide bondi462 ↔ 517PROSITE-ProRule annotation
Disulfide bondi562 ↔ 610PROSITE-ProRule annotation
Glycosylationi644N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Disulfide bondi653 ↔ 718PROSITE-ProRule annotation
Glycosylationi895N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi925N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi945N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi974N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi979N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi986N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi1002N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi1092N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi1177GPI-anchor amidated serineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
H2KZ60

PeptideAtlas

More...
PeptideAtlasi
H2KZ60

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in neurons including the I1 and I3 pharyngeal interneurons, NSM and VNC motor neurons, HSN and CAN neurons, the ALM and PLM touch receptor neurons and other unidentified head neurons. Also expressed in somatic muscles, the excretory canal, the excretory cell and the hypodermis.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed throughout embryonic development and adulthood.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00016354 Expressed in 4 organ(s), highest expression level in pharyngeal muscle cell (C elegans)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
6239.C33F10.5b

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini144 – 225Ig-like C2-type 1PROSITE-ProRule annotationAdd BLAST82
Domaini232 – 319Ig-like C2-type 2PROSITE-ProRule annotationAdd BLAST88
Domaini355 – 438Ig-like C2-type 3PROSITE-ProRule annotationAdd BLAST84
Domaini441 – 533Ig-like C2-type 4PROSITE-ProRule annotationAdd BLAST93
Domaini539 – 626Ig-like C2-type 5PROSITE-ProRule annotationAdd BLAST88
Domaini631 – 730Ig-like C2-type 6PROSITE-ProRule annotationAdd BLAST100
Domaini736 – 844Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST109
Domaini849 – 961Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST113
Domaini963 – 1057Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST95
Domaini1064 – 1168Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST105

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3513 Eukaryota
ENOG410XSVG LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000021866

Identification of Orthologs from Complete Genome Data

More...
OMAi
RGADNHS

Database of Orthologous Groups

More...
OrthoDBi
655902at2759

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 8 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016187 CTDL_fold
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00041 fn3, 1 hit
PF07679 I-set, 2 hits
PF13895 Ig_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060 FN3, 4 hits
SM00409 IG, 4 hits
SM00408 IGc2, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 5 hits
SSF49265 SSF49265, 2 hits
SSF56436 SSF56436, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 4 hits
PS50835 IG_LIKE, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform dImported (identifier: H2KZ60-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMMLIRCISI FLLFGFVNAL IDEASCPIGW QIASDQCVRI VIAPANLKHS
60 70 80 90 100
KKYCHHEGGE LMDTSVTLLL EDVMDLLKNL HENGLSEPTF HVGGMGQALN
110 120 130 140 150
RTEDGNYKII TINPSSHFPF ICSLNKMARR SLLFQQKLLP VGAPQISLTG
160 170 180 190 200
QSEIYFHPRH DADYIALPCT VQGNPKPTVA WYKNDVEVLS PSMSNVSYLL
210 220 230 240 250
SGGNLLVPAS STLAYSSFHC TARNSLGEVR SPPILLKPSF IDPFRPHRLD
260 270 280 290 300
VYSLATGGAK LDCDAPAHQP KSLTYSWLYG SSTDRILSQN ERKFISLDGT
310 320 330 340 350
LFFSYVTAED EDSYACSLSV YSTQSGHYGP FFRLISSTPK LVNSTFPPKL
360 370 380 390 400
DSTQPQIFPE DPKVGDSIYL ECFAYASPLP QYKWSRVDGK PIPARSHISN
410 420 430 440 450
YGRVLKIEKV NYGDAGKYKC VAMNAFGSAA GEVHVKLRAP PSILQGLHDR
460 470 480 490 500
LVPTESNVSF ECLLSNADSY SSVEWFKDAK PIVPLLLPAE KRKRLKIDHN
510 520 530 540 550
VLHLKFADET DSGVYQCVAS NDVGSSSSSA LLTVKDSAPV FPPNAMSRKV
560 570 580 590 600
FAAFGSTVSI PCIFEASPRF HGKWADAGGS KLPQKGRIRD EEGVISIEKV
610 620 630 640 650
LHEDAGLFFC TAHNKLGKAH AQVQLIVVNK PSIKTNFLDE ETVNMSCEVE
660 670 680 690 700
LTCENSAECP EALFEWKIND RPAKEYPSLK SKVHEKKSGH KGRHLKQKVD
710 720 730 740 750
LEVPKSLAGS RQIGRFACSS LYGGSSEFVT KPQLPSPIAL TVEQMDEDGK
760 770 780 790 800
KKKMFRLRWR LPPQHRDTRD HSPKVEGYLV ELRTRKNRKW RAAERQLVGN
810 820 830 840 850
MEKDSITVEN LLPNTEYQFR VRSVESAAIG EPSIPSDWVK TAPGAPSETI
860 870 880 890 900
DNLKWRSLDS QTLLVEWQPI EIGQESSGDN LRYRVSWSEA TVGKNATDDM
910 920 930 940 950
KLSNQDDDFE NHLDSDQPQA ILKLNTTEGC RMVVLAVRPV NDQGNGSVGT
960 970 980 990 1000
DTIAFLNSHG ELKKVSLHNV KPINASHVNI SWTWDNTSDC DTKHAVQITC
1010 1020 1030 1040 1050
INLSGSEISA TVASDRIFWM LGGLEAETAY DCDLKAIDNH GSFGPASKKF
1060 1070 1080 1090 1100
RIHTKQHPPS ETPLIGKLMM KQMKDTYTTI LEWSSIELQK PNRTENGCGY
1110 1120 1130 1140 1150
KIFIYISETA TEAIELDMPL QRLSDRRNPS ARLDGLKLMY MYTIKVAGYN
1160 1170 1180 1190
PGGIGPISEP RSIRLGSPGT MDYTTGSSDV PIPSLLLLLL LLLWRL
Length:1,196
Mass (Da):132,852
Last modified:March 21, 2012 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDD9C91B21F228CBA
GO
Isoform aImported (identifier: H2KZ60-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-313: MMMLIRCISI...SYVTAEDEDS → MFSLLFLKCS...AQTRTDRSFF

Show »
Length:964
Mass (Da):107,766
Checksum:iA5F364A0EF9C6D80
GO
Isoform bImported (identifier: H2KZ60-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MMMLIRCISIFLLFGFVNALID → MRISKKTILSAYEVIDVGNKAADSPTISKMLSENFGLKFFSIKRFLAMKYSNH

Show »
Length:1,227
Mass (Da):136,319
Checksum:i1E808292F7BD2C3A
GO
Isoform cImported (identifier: H2KZ60-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-422: Missing.

Show »
Length:774
Mass (Da):86,032
Checksum:i065DBCA938D00B92
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0585041 – 422Missing in isoform c. CuratedAdd BLAST422
Alternative sequenceiVSP_0585051 – 313MMMLI…EDEDS → MFSLLFLKCSHLKVKRGTQE FLVWFSFTISLALLFYPNLV QIFKSTTSIPNIPKVWWCLF PSSNPITLWSYAQTRTDRSF F in isoform a. CuratedAdd BLAST313
Alternative sequenceiVSP_0585061 – 22MMMLI…NALID → MRISKKTILSAYEVIDVGNK AADSPTISKMLSENFGLKFF SIKRFLAMKYSNH in isoform b. CuratedAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BX284602 Genomic DNA Translation: CCD66510.1
BX284602 Genomic DNA Translation: CCD66507.1
BX284602 Genomic DNA Translation: CCD66508.1
BX284602 Genomic DNA Translation: CCD66509.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T15746

NCBI Reference Sequences

More...
RefSeqi
NP_001022014.1, NM_001026843.3 [H2KZ60-1]
NP_494861.1, NM_062460.3
NP_494862.1, NM_062461.4
NP_740979.1, NM_170981.4 [H2KZ60-4]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
C33F10.5c.1; C33F10.5c.1; WBGene00016354 [H2KZ60-4]
C33F10.5c.2; C33F10.5c.2; WBGene00016354 [H2KZ60-4]
C33F10.5d.1; C33F10.5d.1; WBGene00016354 [H2KZ60-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
173828

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_C33F10.5

UCSC genome browser

More...
UCSCi
C33F10.5c.1 c. elegans

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX284602 Genomic DNA Translation: CCD66510.1
BX284602 Genomic DNA Translation: CCD66507.1
BX284602 Genomic DNA Translation: CCD66508.1
BX284602 Genomic DNA Translation: CCD66509.1
PIRiT15746
RefSeqiNP_001022014.1, NM_001026843.3 [H2KZ60-1]
NP_494861.1, NM_062460.3
NP_494862.1, NM_062461.4
NP_740979.1, NM_170981.4 [H2KZ60-4]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi6239.C33F10.5b

Proteomic databases

EPDiH2KZ60
PeptideAtlasiH2KZ60

Genome annotation databases

EnsemblMetazoaiC33F10.5c.1; C33F10.5c.1; WBGene00016354 [H2KZ60-4]
C33F10.5c.2; C33F10.5c.2; WBGene00016354 [H2KZ60-4]
C33F10.5d.1; C33F10.5d.1; WBGene00016354 [H2KZ60-1]
GeneIDi173828
KEGGicel:CELE_C33F10.5
UCSCiC33F10.5c.1 c. elegans

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
173828
WormBaseiC33F10.5a ; CE04138 ; WBGene00016354 ; rig-6
C33F10.5b ; CE25803 ; WBGene00016354 ; rig-6
C33F10.5c ; CE31679 ; WBGene00016354 ; rig-6
C33F10.5d ; CE37327 ; WBGene00016354 ; rig-6

Phylogenomic databases

eggNOGiKOG3513 Eukaryota
ENOG410XSVG LUCA
HOGENOMiHOG000021866
OMAiRGADNHS
OrthoDBi655902at2759

Miscellaneous databases

Protein Ontology

More...
PROi
PR:H2KZ60

Gene expression databases

BgeeiWBGene00016354 Expressed in 4 organ(s), highest expression level in pharyngeal muscle cell (C elegans)

Family and domain databases

CDDicd00063 FN3, 1 hit
Gene3Di2.60.40.10, 8 hits
InterProiView protein in InterPro
IPR016187 CTDL_fold
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
PfamiView protein in Pfam
PF00041 fn3, 1 hit
PF07679 I-set, 2 hits
PF13895 Ig_2, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 4 hits
SM00409 IG, 4 hits
SM00408 IGc2, 4 hits
SUPFAMiSSF48726 SSF48726, 5 hits
SSF49265 SSF49265, 2 hits
SSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50853 FN3, 4 hits
PS50835 IG_LIKE, 6 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRIG6_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: H2KZ60
Secondary accession number(s): Q18382, Q8MQA8, Q9BIA2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 5, 2016
Last sequence update: March 21, 2012
Last modified: October 16, 2019
This is version 66 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again