Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 79 (13 Nov 2019)
Sequence version 1 (14 Dec 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1

Gene

plc-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes (PubMed:9497345). plc-1 is a bifunctional enzyme which also regulates small GTPases of the Ras superfamily through its Ras guanine-exchange factor (RasGEF) activity (By similarity). By activating IP3 receptor itr-1-mediated intracellular Ca2+ release via the production of IP3, regulates ovulation by controlling contraction and/or dilation of the distal spermatheca valve during oocyte entry and the timing of the dilation of the spermatheca-uterine valve during oocyte exit (PubMed:23671426, PubMed:15355798, PubMed:18369461, PubMed:15194811). In a similar manner, plays an essential role in epidermal morphogenesis by regulating migration of epidermal cells during ventral closure and to a lesser extent by regulating epidermal cell dorsal intercalation (PubMed:18369461). Involved in the immune response to S.aureus bacterium by activating kinase dkf-1 via the production of DAG which in turn activates transcription factor hlh-30 (PubMed:27184844). In ASER neurons, required for adjusting the orientation behavior in salt gradients based on the memory of previous salt concentration encountered (PubMed:23887678).By similarity7 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei925PROSITE-ProRule annotation1
Active sitei970PROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor, Hydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-1855204 Synthesis of IP3 and IP4 in the cytosol

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1By similarity (EC:3.1.4.11UniRule annotation1 Publication)
Alternative name(s):
Phosphoinositide phospholipase C-epsilon plc-1Curated
Phosphoinositide-specific phospholipase PLC2101 Publication
Phospholipase C-epsilon plc-1Curated
Short name:
PLC-epsilon plc-1Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:plc-1Imported
ORF Names:F31B12.1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegansImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

WormBase

More...
WormBasei
F31B12.1a ; CE28227 ; WBGene00004036 ; plc-1
F31B12.1b ; CE31494 ; WBGene00004036 ; plc-1
F31B12.1c ; CE31495 ; WBGene00004036 ; plc-1
F31B12.1d ; CE42555 ; WBGene00004036 ; plc-1
F31B12.1e ; CE42678 ; WBGene00004036 ; plc-1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown results in 52 percent of animals arrested at the embryonic stage (PubMed:18369461). RNAi-mediated knockdown in larvae causes a severe decrease in brood size (PubMed:15194811). In 20 percent of animals, spermatheca dilatation is impaired causing oocyte retention in the gonad and persistent triggering of ovulatory contractions (PubMed:15194811). In L4 larvae, results in a shortened lifespan (PubMed:27184844). Prevents transcription factor hlh-30 nuclear translocation and increases lifespan in response to S.aureus infection (PubMed:27184844).3 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004374641 – 18981-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1CuratedAdd BLAST1898

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
G5EFI8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the spermatheca, vulva, intestine and excretory cells (PubMed:15355798). Expressed in sensory neurons AWC, AFD, ASE, ASG and BAG, interneurons, ventral nerve cord neurons and tail neurons (PubMed:15355798, PubMed:23887678). Expressed in body muscles (PubMed:23887678).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00004036 Expressed in 4 organ(s), highest expression level in material anatomical entity

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
G5EFI8 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via Ras-associating domain 1) with let-60 (in GTP-bound form).

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
6239.F31B12.1a

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini66 – 328Ras-GEFPROSITE-ProRule annotationAdd BLAST263
Domaini910 – 1058PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST149
Domaini1279 – 1385PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST107
Domaini1411 – 1494C2PROSITE-ProRule annotationAdd BLAST84
Domaini1570 – 1665Ras-associating 1PROSITE-ProRule annotationAdd BLAST96
Domaini1738 – 1857Ras-associating 2PROSITE-ProRule annotationAdd BLAST120

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Only Ras-associating 1 domain is involved in the binding to let-60.1 Publication

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0169 Eukaryota
ENOG410XPSW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157356

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
G5EFI8

KEGG Orthology (KO)

More...
KOi
K05860

Identification of Orthologs from Complete Genome Data

More...
OMAi
NMEPAIY

Database of Orthologous Groups

More...
OrthoDBi
368239at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
G5EFI8

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.840.10, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR001192 PI-PLC_fam
IPR028398 PLC-epsilon1
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y
IPR000159 RA_dom
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR029071 Ubiquitin-like_domsf

The PANTHER Classification System

More...
PANTHERi
PTHR10336 PTHR10336, 2 hits
PTHR10336:SF6 PTHR10336:SF6, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168 C2, 1 hit
PF09279 EF-hand_like, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit
PF00788 RA, 2 hits
PF00617 RasGEF, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00390 PHPHLIPASEC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239 C2, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit
SM00314 RA, 2 hits
SM00147 RasGEF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473 SSF47473, 1 hit
SSF48366 SSF48366, 1 hit
SSF51695 SSF51695, 1 hit
SSF54236 SSF54236, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004 C2, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit
PS50200 RA, 2 hits
PS50009 RASGEF_CAT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform aImported (identifier: G5EFI8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNWDTLKGVL KTRRLTKRTI PAYIHPTSRS DSTSSTQSAT AGFILNEEPI
60 70 80 90 100
TLFRLELERL QYILHFPEEV AFQLSSTEYQ LFYSIQPMDY VRYVSCDLTS
110 120 130 140 150
VPVSENPSPV RNLVKRLSEV SSWITHVIVS QPTHDDRKVA LTAILRIVET
160 170 180 190 200
CWNIGNFNAA VEVLMGLKSE KLRPFWLSLR QEEKSQFDSL CETLLPANQA
210 220 230 240 250
LPSQAYINAV QRALRMPQSR VIPFFGIFLR DLYAIVNDLP NIVVIGQEGE
260 270 280 290 300
TQKLEFMSDP NGEDHFSSRI GVGGLLNADK INLVAIVLDN LELFHRHSRT
310 320 330 340 350
MIKLLEEQAV PPIQIPQNER EQKEKEAKTY EPVQVVRGSS HGVALIPLDT
360 370 380 390 400
LTFDLDVIQR LQHGTTVIHY EPDSGRSNLC LLRLDPSCGQ INWHKISYSV
410 420 430 440 450
NKDPKEKDVL AKVSVSNLQP LDSGRGAPSP MPSGRTPGTG GVGVEEGELK
460 470 480 490 500
LSVVKGVELV DSYDIDIEAI YRRHSMEEMS VPVSCWKVSH GQLLSDNEFI
510 520 530 540 550
YFLAPQQIAQ FWTNGLQSVV KSLQGQQRYP DRRMLWIKNV YLSLYEITGE
560 570 580 590 600
SNCGPRPFEA LQAFGLSQTN TNATRPNDSS LSSEPGGAKS RLKNLKNAMQ
610 620 630 640 650
KKLRGASREG SRSQSPQPHS PLVRPPSIKS QISSQSGPPG PNSPGYLLKP
660 670 680 690 700
RGEPANSDAG DIDSIYTPRS RTPTSSSYGG RSVGGRSCKS WRSRGGETPN
710 720 730 740 750
SGSISSSGQM SIQVSGLSGP SGKEFQEKPL TLVEFAELFR LFNTRMRKDL
760 770 780 790 800
RDVFNDVLST ATTPQHCPKR ERDRHSPRMQ SRLASVSNSY NADFLSNDFL
810 820 830 840 850
TRNTAVTSHH ISEKQNKIYN ALALASVNSM GGLMDTSRSS MLTPQMLRAF
860 870 880 890 900
VNTHQMEQID EQTAIKLIQD HEPDGICRQK NQMSFEGFTR FLCDPVNFAF
910 920 930 940 950
VPETIEPDEE DLRYPLSHYY INSSHNTYLT GHQLKGPSSS EMYRQVLLTG
960 970 980 990 1000
CRCVELDCWD GDDGLPLIYH GHTLVSKIGF RQVVEIIKKS AFITSDLPVI
1010 1020 1030 1040 1050
LSIENHCSLQ QQAKMAQMFK TVLGDLLVSN FLFEADFSDS PRLPCPLQMK
1060 1070 1080 1090 1100
NKILIKNKKM IVDPPTPLPM IERGAVQRGE TQLNLHRKQS KNSYESSTVD
1110 1120 1130 1140 1150
EVEDDDLDEF LDDEENEEDD QEEVQVRSEK EDSPKTSKRA EKSARNIKQQ
1160 1170 1180 1190 1200
DSLCSDHSVE QAKPSTSKTT SKTNDRKTED EVLYAQLAQN AIRNQQPRKN
1210 1220 1230 1240 1250
NTGVQIAPEL SDIVIYMQAT KFKGFPPVDG IQSPRIMEEG PASASLSFSS
1260 1270 1280 1290 1300
RARTPSNLLN TPAPPRRQRS STQLSQELAA EFLGSVRANA TATCYQVTSL
1310 1320 1330 1340 1350
NENAAKKLMK RHPAKCVSYT RDHLIRTYPS AKHYDSSNFN PINCWAHGMQ
1360 1370 1380 1390 1400
MVALNFQTPD VIMAVNQAMF EQSGNCGYQL KPRCLWDESH LLYNKFLPLS
1410 1420 1430 1440 1450
KDIAGHSALL LNLTIISGQH VYPNTHYASL YVEIEVIGIH NDCVREKSKV
1460 1470 1480 1490 1500
VQRNSVNPIW NHTTQLRIAC VDLAFLRIAV CDSGQNGRVV AHRVVPVKCI
1510 1520 1530 1540 1550
RPGFRHLPLR TPTNLPIDNA MIFLRTRFEQ EEHIYLHDDD SNTYCNLEHT
1560 1570 1580 1590 1600
LAYRTDLTPN LSPTPILKKQ IFVLRITGAF ADETAITVHS ESGSTVKTVM
1610 1620 1630 1640 1650
QQALLNAGKN ADQVEEYVLI EESLPAPSGE DPIEQRVLPL NEPIMDAVAC
1660 1670 1680 1690 1700
WNGSMRRFVL RKKGSDPSSR AWITSIIKSG TSGSSTSVSP SPLTKDGHVK
1710 1720 1730 1740 1750
SASSNQLHGR SLDTDAFGEH LEVTEGKWLN PRARSMGDTF LVCVHNVSED
1760 1770 1780 1790 1800
QPYAILRAGI HSTAADIIRQ VFVKARRSNV DDSEFVLVEE TCDDPKLNQG
1810 1820 1830 1840 1850
QSMLQALSLA RKRSNDLTPK YPNNRTTSRV LGQNENVWKA QSRWKSMGRF
1860 1870 1880 1890
VLENRKDTVH ATLEKEFHEM AKIIREGIPK KDETYYMIYY SGLPGEDI
Length:1,898
Mass (Da):212,879
Last modified:December 14, 2011 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC10F8EBBF1D647DD
GO
Isoform bImported (identifier: G5EFI8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1727-1728: Missing.
     1802-1817: SMLQALSLARKRSNDL → M
     1866-1885: EFHEMAKIIREGIPKKDETY → VRSFISKLEAAKASMDPRHE
     1886-1898: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,868
Mass (Da):209,246
Checksum:i91627336B12478AA
GO
Isoform cImported (identifier: G5EFI8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1802-1817: SMLQALSLARKRSNDL → M
     1866-1898: EFHEMAKIIREGIPKKDETYYMIYYSGLPGEDI → GRRVESTTSS...KSLTMDAGPK

Note: No experimental confirmation available.Curated
Show »
Length:1,895
Mass (Da):212,132
Checksum:iC088164F1C966E14
GO
Isoform dImported (identifier: G5EFI8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MNWDTLKGVLKTRRLTKRTIPAYIHP → MTLWEIMQNSASNSIQRSLNQSMHRSHTEATVS
     1727-1728: Missing.
     1802-1817: SMLQALSLARKRSNDL → M
     1866-1885: EFHEMAKIIREGIPKKDETY → VRSFISKLEAAKASMDPRHE
     1886-1898: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,875
Mass (Da):209,912
Checksum:i4FE1A55F7568D465
GO
Isoform eImported (identifier: G5EFI8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     565-565: G → GGRVERWKGFG
     1727-1728: Missing.
     1802-1817: SMLQALSLARKRSNDL → M
     1866-1885: EFHEMAKIIREGIPKKDETY → VRSFISKLEAAKASMDPRHE
     1886-1898: Missing.

Show »
Length:1,878
Mass (Da):210,419
Checksum:i8F186BA783EB30FC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G5EFG8G5EFG8_CAEEL
Phosphoinositide phospholipase C
plc-1 CELE_F31B12.1, F31B12.1
1,886Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A4V0IJW2A0A4V0IJW2_CAEEL
PhosphoLipase C
plc-1 CELE_F31B12.1, F31B12.1
3,494Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A4V0IK11A0A4V0IK11_CAEEL
PhosphoLipase C
plc-1 CELE_F31B12.1, F31B12.1
3,497Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A4V0IKD8A0A4V0IKD8_CAEEL
PhosphoLipase C
plc-1 CELE_F31B12.1, F31B12.1
3,504Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A4V0IMY5A0A4V0IMY5_CAEEL
PhosphoLipase C
plc-1 CELE_F31B12.1, F31B12.1
3,487Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A4V0IN51A0A4V0IN51_CAEEL
PhosphoLipase C
plc-1 CELE_F31B12.1, F31B12.1
3,544Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A4V6M3C0A0A4V6M3C0_CAEEL
PhosphoLipase C
plc-1 CELE_F31B12.1, F31B12.1
3,554Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0585311 – 26MNWDT…AYIHP → MTLWEIMQNSASNSIQRSLN QSMHRSHTEATVS in isoform d. CuratedAdd BLAST26
Alternative sequenceiVSP_058532565G → GGRVERWKGFG in isoform e. Curated1
Alternative sequenceiVSP_0585331727 – 1728Missing in isoform b, isoform d and isoform e. Curated2
Alternative sequenceiVSP_0585341802 – 1817SMLQA…RSNDL → M in isoform b, isoform c, isoform d and isoform e. CuratedAdd BLAST16
Alternative sequenceiVSP_0585351866 – 1898EFHEM…PGEDI → GRRVESTTSSSTTTRKISLS SVRSIGLPRKFSKFGKSLTM DAGPK in isoform c. CuratedAdd BLAST33
Alternative sequenceiVSP_0585361866 – 1885EFHEM…KDETY → VRSFISKLEAAKASMDPRHE in isoform b, isoform d and isoform e. CuratedAdd BLAST20
Alternative sequenceiVSP_0585371886 – 1898Missing in isoform b, isoform d and isoform e. CuratedAdd BLAST13

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF044576 mRNA Translation: AAC38963.1
AM992255 mRNA Translation: CAQ51495.1
BX284606 Genomic DNA Translation: CAB60281.3
BX284606 Genomic DNA Translation: CAB60282.4
BX284606 Genomic DNA Translation: CAD44124.1
BX284606 Genomic DNA Translation: CAQ35039.1
BX284606 Genomic DNA Translation: CAQ58108.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T42440

NCBI Reference Sequences

More...
RefSeqi
NP_001024617.1, NM_001029446.2 [G5EFI8-1]
NP_001024619.1, NM_001029448.3 [G5EFI8-3]
NP_001123141.1, NM_001129669.2
NP_001129926.1, NM_001136454.1 [G5EFI8-5]
NP_509805.3, NM_077404.5 [G5EFI8-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
F31B12.1a.1; F31B12.1a.1; WBGene00004036 [G5EFI8-1]
F31B12.1b.1; F31B12.1b.1; WBGene00004036 [G5EFI8-2]
F31B12.1c.1; F31B12.1c.1; WBGene00004036 [G5EFI8-3]
F31B12.1d.1; F31B12.1d.1; WBGene00004036 [G5EFI8-4]
F31B12.1e.1; F31B12.1e.1; WBGene00004036 [G5EFI8-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
181274

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_F31B12.1

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF044576 mRNA Translation: AAC38963.1
AM992255 mRNA Translation: CAQ51495.1
BX284606 Genomic DNA Translation: CAB60281.3
BX284606 Genomic DNA Translation: CAB60282.4
BX284606 Genomic DNA Translation: CAD44124.1
BX284606 Genomic DNA Translation: CAQ35039.1
BX284606 Genomic DNA Translation: CAQ58108.1
PIRiT42440
RefSeqiNP_001024617.1, NM_001029446.2 [G5EFI8-1]
NP_001024619.1, NM_001029448.3 [G5EFI8-3]
NP_001123141.1, NM_001129669.2
NP_001129926.1, NM_001136454.1 [G5EFI8-5]
NP_509805.3, NM_077404.5 [G5EFI8-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi6239.F31B12.1a

Proteomic databases

PaxDbiG5EFI8

Genome annotation databases

EnsemblMetazoaiF31B12.1a.1; F31B12.1a.1; WBGene00004036 [G5EFI8-1]
F31B12.1b.1; F31B12.1b.1; WBGene00004036 [G5EFI8-2]
F31B12.1c.1; F31B12.1c.1; WBGene00004036 [G5EFI8-3]
F31B12.1d.1; F31B12.1d.1; WBGene00004036 [G5EFI8-4]
F31B12.1e.1; F31B12.1e.1; WBGene00004036 [G5EFI8-5]
GeneIDi181274
KEGGicel:CELE_F31B12.1

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
181274
WormBaseiF31B12.1a ; CE28227 ; WBGene00004036 ; plc-1
F31B12.1b ; CE31494 ; WBGene00004036 ; plc-1
F31B12.1c ; CE31495 ; WBGene00004036 ; plc-1
F31B12.1d ; CE42555 ; WBGene00004036 ; plc-1
F31B12.1e ; CE42678 ; WBGene00004036 ; plc-1

Phylogenomic databases

eggNOGiKOG0169 Eukaryota
ENOG410XPSW LUCA
GeneTreeiENSGT00940000157356
InParanoidiG5EFI8
KOiK05860
OMAiNMEPAIY
OrthoDBi368239at2759
PhylomeDBiG5EFI8

Enzyme and pathway databases

ReactomeiR-CEL-1855204 Synthesis of IP3 and IP4 in the cytosol

Miscellaneous databases

Protein Ontology

More...
PROi
PR:G5EFI8

Gene expression databases

BgeeiWBGene00004036 Expressed in 4 organ(s), highest expression level in material anatomical entity
ExpressionAtlasiG5EFI8 baseline and differential

Family and domain databases

Gene3Di1.10.840.10, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR001192 PI-PLC_fam
IPR028398 PLC-epsilon1
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y
IPR000159 RA_dom
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR10336 PTHR10336, 2 hits
PTHR10336:SF6 PTHR10336:SF6, 2 hits
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF09279 EF-hand_like, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit
PF00788 RA, 2 hits
PF00617 RasGEF, 1 hit
PRINTSiPR00390 PHPHLIPASEC
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit
SM00314 RA, 2 hits
SM00147 RasGEF, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF48366 SSF48366, 1 hit
SSF51695 SSF51695, 1 hit
SSF54236 SSF54236, 2 hits
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit
PS50200 RA, 2 hits
PS50009 RASGEF_CAT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLCE1_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: G5EFI8
Secondary accession number(s): G5ED55
, G5EEI0, G5EEJ6, G5EFI5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 5, 2016
Last sequence update: December 14, 2011
Last modified: November 13, 2019
This is version 79 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again