Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 87 (02 Jun 2021)
Sequence version 1 (14 Dec 2011)
Previous versions | rss
Add a publicationFeedback
Protein

LIM domain-binding protein 1

Gene

ldb-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to the LIM domain of LIM domain-containing transcription factors (PubMed:10993673).

Required for the blmp-1-mediated transcriptional activation or repression of several hypodermal genes, such as bed-3 (PubMed:32417234).

Regulates sam-10 nuclear localization in PLM neurons (PubMed:21115607).

Has a role in synaptic differentiation of PLM mechanosensory neurons (PubMed:21115607).

Involved in gonadogenesis (PubMed:12736204).

4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
LIM domain-binding protein 1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ldb-1Imported
ORF Names:F58A3.1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegansImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

WormBase

More...
WormBasei
F58A3.1a ; CE11350 ; WBGene00002261 ; ldb-1
F58A3.1b ; CE11352 ; WBGene00002261 ; ldb-1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown causes mechanosensory defects and uncoordination in L1 and L2 larval stage animals; phenotypes become weaker in later stages and eventually disappear in young adults (PubMed:10993673). RNAi-mediated knockdown causes defects in vulval morphology and gonad arms (PubMed:12736204). RNAi-mediated knockdown reduces the level of bed-3 and col-124 mRNAs and increases the level of lin-29 mRNA (PubMed:32417234).3 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004511561 – 592LIM domain-binding protein 1Add BLAST592

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8I4H8

PeptideAtlas

More...
PeptideAtlasi
G5EEL0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all neurons and some other tissues of the adult, including vulval muscle, and, in males, all the neurons of the tail region (PubMed:10993673). Expressed in vulval cells (PubMed:12736204, PubMed:10993673).2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

First expressed widely in 200- to 260-minute-old embryo, except in hyp-7 cells (PubMed:10993673). Expression becomes more restricted to the anterior, ventral, and posterior part in the comma stage embryo (PubMed:10993673). Expressed in all neurons and some other tissues of the larva (PubMed:10993673). Expressed in primary vulval cells during the L4 larval stage (PubMed:12736204).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00002261, Expressed in pharyngeal muscle cell (C elegans) and 5 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
G5EEL0, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with blmp-1.

1 Publication

GO - Molecular functioni

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
G5EEL0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini378 – 417LIM interaction domain (LID)PROSITE-ProRule annotationAdd BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni14 – 41DisorderedSequence analysisAdd BLAST28
Regioni305 – 368DisorderedSequence analysisAdd BLAST64
Regioni437 – 458DisorderedSequence analysisAdd BLAST22
Regioni559 – 592DisorderedSequence analysisAdd BLAST34

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi27 – 41Polar residuesSequence analysisAdd BLAST15
Compositional biasi348 – 368Polar residuesSequence analysisAdd BLAST21
Compositional biasi572 – 586Pro residuesSequence analysisAdd BLAST15

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the LDB family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2181, Eukaryota
ENOG410YZVH, LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000005639

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_434933_0_0_1

Identification of Orthologs from Complete Genome Data

More...
OMAi
LEFRIHD

Database of Orthologous Groups

More...
OrthoDBi
849287at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR041363, LID
IPR029005, LIM-bd/SEUSS

The PANTHER Classification System

More...
PANTHERi
PTHR10378, PTHR10378, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17916, LID, 1 hit
PF01803, LIM_bind, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51957, LID, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform aImported (identifier: G5EEL0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYGHHPDYGY GNYGHPPPFA GPESSNSHYG MPPSQGTNSQ NNMMMRSQAT
60 70 80 90 100
EPQPIGNTVS PLEFRIHDMN RRLYIFSSTG VSENDQQQWW DAFSHEFFDD
110 120 130 140 150
DCKLWFVIGS EPVAFASRER YIINRQFIPK FFRSIFDSGM RELQYVLRGP
160 170 180 190 200
SRECTLANGS QAYENENVLQ ITRYDQSSQF EVNTEGKLYV EFAPFDEVMN
210 220 230 240 250
YRIKAWTLEL KRSNEFVYNQ NTADYRVEAQ NPEQENKPRM GFFKSTFNLM
260 270 280 290 300
TMLKILDPMQ SIMSSAKSAP AITPREVMKR TLFQHHQVRQ QNMRQQQLNQ
310 320 330 340 350
QMMIPAPEPE KPKPARKRQR KPAANPRGSK KATAAAAAAA AAATNGVPPT
360 370 380 390 400
VPTASPANNQ QFPPNPMTSQ FQQMSYPDVM VVGEPSMMGS EFGENDERTI
410 420 430 440 450
SRVENSQYDP NAMQMQSLGQ GPNSSMNING RNMMNQHHPG MQPPPGQQHM
460 470 480 490 500
PPHSMGSQMP TSMHNPMHMP PGSMQGHGGM PPMPSTMANQ MPPPNLPPHT
510 520 530 540 550
MSNQMPNSRM PPMQGQMPPS GMPGQMSNPN MMGSGMPPMS MSSQMPGSMS
560 570 580 590
NPMPNQMPGG MQMNQMPPPN YSQYTGGPPP QWPPPNSAMI TG
Length:592
Mass (Da):66,338
Last modified:December 14, 2011 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i930CA0DC499BBE5E
GO
Isoform bImported (identifier: G5EEL0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-44: YGHHPDYGYGNYGHPPPFAGPESSNSHYGMPPSQGTNSQNNMM → FHRPPSARPPLNHVDQLKSLQATALGKPG

Show »
Length:578
Mass (Da):64,791
Checksum:i59EA65AD22B41BCF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q9U3E2Q9U3E2_CAEEL
LID domain-containing protein
ldb-1 CELE_F58A3.1, F58A3.1
629Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB38367 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0607582 – 44YGHHP…QNNMM → FHRPPSARPPLNHVDQLKSL QATALGKPG in isoform b. CuratedAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U80220 mRNA Translation: AAB38366.1
U80221 mRNA Translation: AAB38367.1 Different initiation.
BX284606 Genomic DNA Translation: CAB02669.1
BX284606 Genomic DNA Translation: CAB02672.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T22885
T22888

NCBI Reference Sequences

More...
RefSeqi
NP_509845.1, NM_077444.3 [G5EEL0-2]
NP_509846.1, NM_077445.4

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
F58A3.1a.1; F58A3.1a.1; WBGene00002261 [G5EEL0-1]
F58A3.1a.2; F58A3.1a.2; WBGene00002261 [G5EEL0-1]
F58A3.1b.1; F58A3.1b.1; WBGene00002261 [G5EEL0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
181292

UCSC genome browser

More...
UCSCi
F58A3.1c, c. elegans

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U80220 mRNA Translation: AAB38366.1
U80221 mRNA Translation: AAB38367.1 Different initiation.
BX284606 Genomic DNA Translation: CAB02669.1
BX284606 Genomic DNA Translation: CAB02672.1
PIRiT22885
T22888
RefSeqiNP_509845.1, NM_077444.3 [G5EEL0-2]
NP_509846.1, NM_077445.4

3D structure databases

SMRiG5EEL0
ModBaseiSearch...

Proteomic databases

EPDiQ8I4H8
PeptideAtlasiG5EEL0

Genome annotation databases

EnsemblMetazoaiF58A3.1a.1; F58A3.1a.1; WBGene00002261 [G5EEL0-1]
F58A3.1a.2; F58A3.1a.2; WBGene00002261 [G5EEL0-1]
F58A3.1b.1; F58A3.1b.1; WBGene00002261 [G5EEL0-2]
GeneIDi181292
UCSCiF58A3.1c, c. elegans

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
181292
WormBaseiF58A3.1a ; CE11350 ; WBGene00002261 ; ldb-1
F58A3.1b ; CE11352 ; WBGene00002261 ; ldb-1

Phylogenomic databases

eggNOGiKOG2181, Eukaryota
ENOG410YZVH, LUCA
GeneTreeiENSGT00390000005639
HOGENOMiCLU_434933_0_0_1
OMAiLEFRIHD
OrthoDBi849287at2759

Gene expression databases

BgeeiWBGene00002261, Expressed in pharyngeal muscle cell (C elegans) and 5 other tissues
ExpressionAtlasiG5EEL0, baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR041363, LID
IPR029005, LIM-bd/SEUSS
PANTHERiPTHR10378, PTHR10378, 1 hit
PfamiView protein in Pfam
PF17916, LID, 1 hit
PF01803, LIM_bind, 1 hit
PROSITEiView protein in PROSITE
PS51957, LID, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLIDB1_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: G5EEL0
Secondary accession number(s): Q8I4H8, Q8IU51
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 7, 2020
Last sequence update: December 14, 2011
Last modified: June 2, 2021
This is version 87 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again