Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 92 (02 Jun 2021)
Sequence version 1 (14 Dec 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Paired box protein 6 homolog

Gene

vab-3

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor that binds a motif with the core sequence 5'-GCGTA-3' in the promoter of various genes (PubMed:11476572, PubMed:30890567).

During development, required for cell fate specification probably by promoting or repressing expression of genes involved in specific cell fate (PubMed:30890567, PubMed:11476572, PubMed:7649393).

Involved in head epidermal morphogenesis (PubMed:7659159).

Involved in gonadal distal tip cell (DTC) migration, during which modulates expression of the integrin alpha genes, pat-2 and ina-1 (PubMed:10388818, PubMed:17606640, PubMed:15579687).

Regulates ventral and dorsal cephalic sheath (CEPsh) glia differentiation and expression of transcription factor hlh-17 in CEPsh glia (PubMed:18508862).

Plays a role in establishing unequal cytokinesis and cell fate specification in male-specific postembryonic blast cell B (PubMed:7649393).

May cooperate with the phosphatase eya-1 and transcription factor ceh-32 to regulate the transcription factor ets-5 (PubMed:30890567).

8 Publications

Transcription factor involved in head epidermal morphogenesis and required for normal cell fate in anterior lateral epidermal blast (seam) cells (PubMed:7659159, PubMed:15579687).

Required for the generation or differentiation of neurons of the anterior ganglion, probably acting upstream of unc-86 (PubMed:8647436).

Represses BAG sensory neuron fate in non-BAG cells, probably through cooperation with the phosphatase eya-1 and transcription factor ceh-32 (PubMed:30890567).

May be involved in regulating the generation of dopaminergic neurons (PubMed:21079745).

May cooperate with hlh-17 to preferentially regulate expression of hlh-17 in ventral CEPsh glia (PubMed:18508862).

6 Publications

Transcription factor that acts within the male-specific genital sensilla (simple sense organs) known as rays to determine their identity (PubMed:7659160, PubMed:1782863, PubMed:15579687).

Promotes BAG sensory neuron fate in a cell-autonomous manner (PubMed:30890567).

Required for function of chemosensory BAG neurons (PubMed:30890567).

4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi5 – 131PairedPROSITE-ProRule annotationAdd BLAST127
DNA bindingi217 – 276HomeoboxPROSITE-ProRule annotationAdd BLAST60

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, DNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-8939245, RUNX1 regulates transcription of genes involved in BCR signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Paired box protein 6 homolog1 Publication
Alternative name(s):
Homeobox and paired domain-containing protein vab-31 Publication
Protein male abnormal 18Imported
Variable abnormal morphology protein 3Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:vab-3Imported
Synonyms:mab-181 PublicationImported, pax-61 Publication
ORF Names:F14F3.1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegansImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

WormBase

More...
WormBasei
F14F3.1a ; CE24899 ; WBGene00006870 ; vab-3
F14F3.1b ; CE28216 ; WBGene00006870 ; vab-3
F14F3.1c ; CE28217 ; WBGene00006870 ; vab-3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown causes defects in gonadal distal tip cell migration (PubMed:17606640). RNAi-mediated knockdown reduces expression of the integrin alpha pat-2 in gonadal DTCs in about 70% of individuals and in 90% on a vab-3 mutant background (PubMed:17606640). RNAi-mediated knockdown increases expression of the integrin alpha ina-1 in gonadal DTCs in hermaphrodites (PubMed:17606640). RNAi-mediated knockdown induces generation of additional dopaminergic neurons (PubMed:21079745). BAG sensory neuron-specific RNAi-mediated knockdown reduces expression of receptor-type guanylyl cyclase gcy-9 (PubMed:30890567).3 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi13G → Q in k143; embryonic lethality in a few mutants. Anterior and posterior defects in gonadal distal tip cell (DTC) migration. No defect in head morphogenesis. 2 Publications1
Mutagenesisi19G → R in sy281; defects in head morphogenesis, resulting from defects in the embryonic migration or determination of head hypodermal cells. Male tail spicule defects. Reduces expression of hlh-17 and ptr-10 in both dorsal and ventral CEPsh glia. 2 Publications1
Mutagenesisi52G → E in mw105; defects in gonadal distal tip cell migration in larval development. About 50% of individuals have reduced expression of the integrin alpha pat-2. Hermaphrodites express integrin alpha ina-1 abnormally, beyond the egg-laying stage. 1 Publication1
Mutagenesisi52G → R in wz25; abnormal BAG sensory neuron fate and inappropriate expression of the transcription factor ets-5 in non-BAG cells. 1 Publication1
Mutagenesisi75S → L in k109; embryonic or larval lethality in a few mutants. Male tail spicule defects. Almost abolishes expression of hlh-17 and ptr-10 in dorsal CEPsh glia, whereas nearly half of animals express both these genes in ventral CEPsh glia. No defect in head morphogenesis. 2 Publications1
Mutagenesisi101 – 455Missing in e648; lethality at embryonic or larval stages. The few surviving adults have defects in head morphogenesis, resulting from defects in the embryonic migration or determination of head hypodermal cells. Male tail spicule defects. Defective dopaminergic neuron specification. Expression of ceh-32 is abolished in some head hypodermal cells. Anatomy of the anterior ganglion is severely disturbed and expression of unc-86 is abolished in several neurons in the head. Defects in gonadal distal tip cell migration in larval development. Abnormal BAG sensory neuron fate. Defects in male specific postembryonic blast cell (B cell) fate specification. Expression of hlh-17 abolished in both dorsal and ventral CEPsh glia. 10 PublicationsAdd BLAST355
Mutagenesisi103I → N in sy66; lethality at embryonic or larval stages. The few surviving adults have defects in head morphogenesis, resulting from defects in the embryonic migration or determination of head hypodermal cells. Male tail spicule defects. Defects in male specific postembryonic blast cell (B cell) fate specification. 3 Publications1
Mutagenesisi120S → N in ns157; defects in AWC, AFD and ADF axon guidance. Shorter CEP dendrites. Almost abolishes expression of hlh-17 and ptr-10 in dorsal CEPsh glia, whereas nearly half of animals express both these genes in ventral CEPsh glia. 1 Publication1
Mutagenesisi149 – 455Missing in e1062; lethality at embryonic or larval stages, or adult head epidermal morphological defects. Male tail spicule defects. Anatomy of the anterior ganglion is severely disturbed and expression of unc-86 is abolished in several neurons in the head. 2 PublicationsAdd BLAST307
Mutagenesisi160 – 455Missing in ot292; defective dopaminergic neuron specification. 1 PublicationAdd BLAST296
Mutagenesisi228 – 455Missing in we4; lethality at embryonic or larval stages, or adult head epidermal morphological defects. 1 PublicationAdd BLAST228
Mutagenesisi229 – 232IESL → TESH in e1796; adult male tail ray morphology defects. Some mutants show defects in gonadal distal tip cell (DTC) migration. Cell fate transformations of head lateral epidermis in some animals. About 50% of individuals have reduced expression of the integrin alpha pat-2. Abolishes expression of hlh-17 in both dorsal and ventral CEPsh glia. 3 Publications4
Mutagenesisi262 – 455Missing in ju468; lethality at embryonic or larval stages, or adult head epidermal morphological defects. Severely defective function of chemosensory BAG neurons. Normal BAG sensory neuron fate, but reduced expression of neuropeptide flp-17 in the BAG neurons. Reduced expression of receptor-type guanylyl cyclase gcy-9. Expression of hlh-17 abolished in both dorsal and ventral CEPsh glia. 3 PublicationsAdd BLAST194
Mutagenesisi338 – 455Missing in ot266; defective dopaminergic neuron specification. Normal BAG sensory neuron fate, but reduced expression of neuropeptide flp-17 in the BAG neurons. 2 PublicationsAdd BLAST118

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004515211 – 455Paired box protein 6 homologAdd BLAST455

Proteomic databases

PeptideAtlas

More...
PeptideAtlasi
G5EDS1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed widely in head epidermal cells and neurons, including BAG sensory neurons.1 Publication
Not expressed in BAG neurons.1 Publication
Expressed in BAG neurons.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in the anterior part of comma-stage embryos (PubMed:11476572, PubMed:18313275). In larvae, expressed strongly in almost all anterior hypodermal cells and weakly in many head neurons (PubMed:7659159, PubMed:18313275). Expressed in the gonadal DTCs during ventral migration in hermaphrodite L4 larvae (PubMed:17606640, PubMed:18313275). Expressed in the male hindgut, in B.a and Y.p sensory organ precursors, from the early L2 and until the mid L3 larval stages (PubMed:18313275). Expression diminishes in the B.a lineage during late L4 tail morphogenesis, and is absent in adults (PubMed:18313275). Expression in the Y.p lineage diminishes in the mid L3 stage (PubMed:18313275). Male hindgut expression is restricted to specific lineages in a lin-48 and egl-38 dependent manner (PubMed:18313275).4 Publications
First expressed at about 5 hours of embryogenesis in 20-30 anterior dorsal cells, corresponding to the hypodermal cells of the head, and lateral sets of about 10 cells, of which some are probably future head neurons (PubMed:7659159). By the 1.5-fold stage, expressed in hypodermal and neuronal cells in a broad region of the head (PubMed:7659159).1 Publication
Expressed in RS.a and RB.p in late larval stage L3, in ray 6 and ray 8 cells in late L4, in neurons descended from P11.a in the preanal ganglion in L4 males and head hypodermis and a pair of bilaterally symmetrical neurons in the head anterior of the nerve ring in L4 males (at protein level) (PubMed:7659160, PubMed:9858725). Also expressed in seminal vesicle cells in late L4 males (at protein level) (PubMed:9858725).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00006870, Expressed in multi-cellular organism and 6 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
G5EDS1, baseline

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
G5EDS1, 80 interactors

STRING: functional protein association networks

More...
STRINGi
6239.F14F3.1a

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
G5EDS1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni8 – 64PAI subdomainPROSITE-ProRule annotationAdd BLAST57
Regioni83 – 131RED subdomainPROSITE-ProRule annotationAdd BLAST49
Regioni274 – 330DisorderedSequence analysisAdd BLAST57

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi284 – 330Polar residuesSequence analysisAdd BLAST47

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the paired homeobox family.Curated

Keywords - Domaini

Homeobox, Paired box

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0849, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000165785

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_019281_1_4_1

Identification of Orthologs from Complete Genome Data

More...
OMAi
MSDAGHT

Database of Orthologous Groups

More...
OrthoDBi
1152885at2759

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00086, homeodomain, 1 hit
cd00131, PAX, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009057, Homeobox-like_sf
IPR017970, Homeobox_CS
IPR001356, Homeobox_dom
IPR043182, PAIRED_DNA-bd_dom
IPR001523, Paired_dom
IPR043565, PAX_fam
IPR036388, WH-like_DNA-bd_sf

The PANTHER Classification System

More...
PANTHERi
PTHR45636, PTHR45636, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00046, Homeodomain, 1 hit
PF00292, PAX, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00027, PAIREDBOX

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00389, HOX, 1 hit
SM00351, PAX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689, SSF46689, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00027, HOMEOBOX_1, 1 hit
PS50071, HOMEOBOX_2, 1 hit
PS00034, PAIRED_1, 1 hit
PS51057, PAIRED_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform aImported (identifier: G5EDS1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDAGHTGVN QLGGVFVNGR PLPDATRQRI VDLAHKGCRP CDISRLLQVS
60 70 80 90 100
NGCVSKILCR YYESGTIRPR AIGGSKPRVA TSDVVEKIED YKRDQPSIFA
110 120 130 140 150
WEIRDKLLAD NICNNETIPS VSSINRVLRN LAAKKEQVTM QTELYDRIRI
160 170 180 190 200
VDNFPYNSSW YGQWPIPMNG AVGLNPFVPA PLIEPKTEGE FEKDEDQKPP
210 220 230 240 250
TEPEDDAAAR MRLKRKLQRN RTSFTQVQIE SLEKEFERTH YPDVFARERL
260 270 280 290 300
AQKIQLPEAR IQVWFSNRRA KWRREEKMRN KRSSGTMDSS LSNGTPTPTP
310 320 330 340 350
GSVTGSNMTN PIGSPASTPN RFPSNNSANL PTTNFVPQTS QMYAGLSQPA
360 370 380 390 400
MDPYSFGIAN GFSMAPYPQV TDFQPHHMFQ GRSPYDFPYP RMPTNGHGFQ
410 420 430 440 450
QSMSPATTAV GDIPTLSSGM SLPVSAVLNS IDPSLTHSQM HELSDLTQEH

YWRPQ
Length:455
Mass (Da):51,061
Last modified:December 14, 2011 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i70D75A22A6739C57
GO
Isoform bImported (identifier: G5EDS1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-194: MSDAGHTGVN...PKTEGEFEKD → MRSIANTN

Show »
Length:269
Mass (Da):30,264
Checksum:iF556504160B7BE34
GO
Isoform cImported (identifier: G5EDS1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-194: MSDAGHTGVN...PKTEGEFEKD → MISAHAPIVSIKAPLPTRRASTIRKTARVGKFSPY

Show »
Length:296
Mass (Da):33,180
Checksum:i820AD036EA148DAC
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC47541 differs from that shown. Probable cloning artifact.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0608001 – 194MSDAG…EFEKD → MRSIANTN in isoform b. CuratedAdd BLAST194
Alternative sequenceiVSP_0608011 – 194MSDAG…EFEKD → MISAHAPIVSIKAPLPTRRA STIRKTARVGKFSPY in isoform c. CuratedAdd BLAST194

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U31537 mRNA Translation: AAA82991.1
U29145 mRNA Translation: AAC47541.1 Sequence problems.
U29184 mRNA Translation: AAC47542.1
BX284606 Genomic DNA Translation: CAA90186.2
BX284606 Genomic DNA Translation: CAC42287.1
BX284606 Genomic DNA Translation: CAC42288.1

Protein sequence database of the Protein Information Resource

More...
PIRi
S60250
S60251
T20900, S60252

NCBI Reference Sequences

More...
RefSeqi
NP_001024570.1, NM_001029399.2 [G5EDS1-1]
NP_001024571.1, NM_001029400.1 [G5EDS1-2]
NP_001024572.1, NM_001029401.3 [G5EDS1-3]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
F14F3.1a.1; F14F3.1a.1; WBGene00006870 [G5EDS1-1]
F14F3.1b.1; F14F3.1b.1; WBGene00006870 [G5EDS1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
181251

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_F14F3.1

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U31537 mRNA Translation: AAA82991.1
U29145 mRNA Translation: AAC47541.1 Sequence problems.
U29184 mRNA Translation: AAC47542.1
BX284606 Genomic DNA Translation: CAA90186.2
BX284606 Genomic DNA Translation: CAC42287.1
BX284606 Genomic DNA Translation: CAC42288.1
PIRiS60250
S60251
T20900, S60252
RefSeqiNP_001024570.1, NM_001029399.2 [G5EDS1-1]
NP_001024571.1, NM_001029400.1 [G5EDS1-2]
NP_001024572.1, NM_001029401.3 [G5EDS1-3]

3D structure databases

SMRiG5EDS1
ModBaseiSearch...

Protein-protein interaction databases

IntActiG5EDS1, 80 interactors
STRINGi6239.F14F3.1a

Proteomic databases

PeptideAtlasiG5EDS1

Genome annotation databases

EnsemblMetazoaiF14F3.1a.1; F14F3.1a.1; WBGene00006870 [G5EDS1-1]
F14F3.1b.1; F14F3.1b.1; WBGene00006870 [G5EDS1-2]
GeneIDi181251
KEGGicel:CELE_F14F3.1

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
181251
WormBaseiF14F3.1a ; CE24899 ; WBGene00006870 ; vab-3
F14F3.1b ; CE28216 ; WBGene00006870 ; vab-3
F14F3.1c ; CE28217 ; WBGene00006870 ; vab-3

Phylogenomic databases

eggNOGiKOG0849, Eukaryota
GeneTreeiENSGT00940000165785
HOGENOMiCLU_019281_1_4_1
OMAiMSDAGHT
OrthoDBi1152885at2759

Enzyme and pathway databases

ReactomeiR-CEL-8939245, RUNX1 regulates transcription of genes involved in BCR signaling

Gene expression databases

BgeeiWBGene00006870, Expressed in multi-cellular organism and 6 other tissues
ExpressionAtlasiG5EDS1, baseline

Family and domain databases

CDDicd00086, homeodomain, 1 hit
cd00131, PAX, 1 hit
Gene3Di1.10.10.10, 2 hits
InterProiView protein in InterPro
IPR009057, Homeobox-like_sf
IPR017970, Homeobox_CS
IPR001356, Homeobox_dom
IPR043182, PAIRED_DNA-bd_dom
IPR001523, Paired_dom
IPR043565, PAX_fam
IPR036388, WH-like_DNA-bd_sf
PANTHERiPTHR45636, PTHR45636, 1 hit
PfamiView protein in Pfam
PF00046, Homeodomain, 1 hit
PF00292, PAX, 1 hit
PRINTSiPR00027, PAIREDBOX
SMARTiView protein in SMART
SM00389, HOX, 1 hit
SM00351, PAX, 1 hit
SUPFAMiSSF46689, SSF46689, 2 hits
PROSITEiView protein in PROSITE
PS00027, HOMEOBOX_1, 1 hit
PS50071, HOMEOBOX_2, 1 hit
PS00034, PAIRED_1, 1 hit
PS51057, PAIRED_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVAB3_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: G5EDS1
Secondary accession number(s): G5EE71, Q17356, Q95ZV2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 2, 2020
Last sequence update: December 14, 2011
Last modified: June 2, 2021
This is version 92 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again