Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 62 (16 Oct 2019)
Sequence version 1 (14 Dec 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Probable dual specificity protein kinase madd-3

Gene

madd-3

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform a: Probable dual specificity kinase acting on both serine/threonine and tyrosine-containing substrates. Negatively regulates p38 MAPK signaling to allow for the plasma membrane of body wall muscle cells to form projections, also called muscle arms, that extend and connect the body wall muscles to target motor neurons. Negative regulation of p38 MAPK signaling may in turn modulate the trafficking of the muscle specific receptor eva-1 to the lysosome, to ensure proper display of the eva-1 receptor on the plasma membrane of muscle cells and allow for muscle arm extension towards guidance cues.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei580ATPCurated1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei677Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi557 – 565ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase, Tyrosine-protein kinase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
G5EDB2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable dual specificity protein kinase madd-3Curated (EC:2.7.11.-PROSITE-ProRule annotation)
Alternative name(s):
Muscle arm development defective protein 3Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:madd-3Imported
Synonyms:tag-172Imported
ORF Names:E02H4.3Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegansImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

WormBase

More...
WormBasei
E02H4.3a ; CE31462 ; WBGene00006517 ; madd-3
E02H4.3b ; CE52798 ; WBGene00006517 ; madd-3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Viable, but sterile. Defective extension of body wall muscle connections or arms towards the ventral nerve cord. Reduced expression of the late endosome marker rab-7, and the eva-1 and unc-40 receptors, which are expressed in muscles, and impaired recruitment of madd-4 to the muscle membrane. Double knockout with cup-5 results in increased expression of the eva-1 receptor and rab-7 positive endosomes. Double knockout with eva-1, gex-2, madd-2, madd-4, mkk-4, unc-15, unc-60, unc-93 or unc-98 results in severe muscle arm extension defects as compared to the single knockouts. Double knockout with proteins involved in the p38 MAPK signaling pathway including cebp-1, mak-2, pmk-3 or sek-3 suppress the muscle arm extension defects and eva-1 expression defects in the madd-3 single knockout. Double knockout with dlk-1 also suppresses the eva-1 expression defect, but does not suppress the muscle arm extension defects in the madd-3 single knockout. Double knockout with cebp-1, mak-2 or pmk-3 restores the defect in the recruitment of madd-4 to the muscle membrane in the madd-3 single knockout. Furthermore, double knockout with pmk-3 restores the reduced rab-7 expression level defect in the madd-3 single knockout. Double knockout with unc-54 results in lethality. Triple knockout with unc-54, and either cebp-1, dlk-1, mak-2, pmk-3 or sek-3 results in paralysis (as in the unc-54 single knockout), and suppresses the lethality phenotype in the double madd-3 and unc-54 mutant.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi580K → R: Kinase dead. Defective extension of muscle arms towards motor neuron targets. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004423421 – 887Probable dual specificity protein kinase madd-3CuratedAdd BLAST887

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
G5EDB2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
G5EDB2

PeptideAtlas

More...
PeptideAtlasi
G5EDB2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform a: Expressed in body wall, vulval and anal depressor muscles.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform a: Expressed from embryogenesis to adulthood.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00006517 Expressed in 5 organ(s), highest expression level in multi-cellular organism

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
6239.E02H4.3a

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
G5EDB2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini551 – 863Protein kinasePROSITE-ProRule annotationAdd BLAST313

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi74 – 300Pro-richPROSITE-ProRule annotationAdd BLAST227

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0671 Eukaryota
ENOG410XQF2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154947

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
G5EDB2

Identification of Orthologs from Complete Genome Data

More...
OMAi
KIKHASP

Database of Orthologous Groups

More...
OrthoDBi
290680at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform aImported (identifier: G5EDB2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPILHQKIAS TGGQPSTNSL ALRRLPLVVI PRKRKYKNYV SRRRNTQLLA
60 70 80 90 100
SLRRCVSDPN VYKSYNHWKA LLRPMTPIKS GAPTPKTVTP MPVPQIPPHQ
110 120 130 140 150
KMTPNPTPTQ NPVQLPLPHA VSEKPGDKKS TGPTPSPVPS KAPISAAKLP
160 170 180 190 200
GTVTKVAPLL SAAQPPPKTL APAPGASETN SGSGPVSKQV SGKLTELKSK
210 220 230 240 250
NGTVTEKTEK AVLRIPSSAS TRAKAASAVA PEANPAPVPT ATKPSPFAPA
260 270 280 290 300
IAPLRDGAPA QPPAPIQASA PLRPPVAKQN SLQKPPEPKR SVGAPPKALP
310 320 330 340 350
SELVNKIDGI EFLPQSSNQN TDDGQQPTTS TGGAKALRRA YGSKSGTTIC
360 370 380 390 400
AIGSPNVPST SQPQQGDNEK RLIEKKLSLR KKKLSGEGVP PAGSMLTGSK
410 420 430 440 450
SGVEIGLSSN LTTTNNNNNK EQTDEQRAKK TVNAVAAAFS TQAGSGNATT
460 470 480 490 500
VDDPASTTTS KENPAAQPPK PKSAAVQNLI SQLQLPASVS AKVDKIIACG
510 520 530 540 550
DKARKPSRSG LQASQARPKV PEIVSSQRTQ HQDDKDGHLI YSKGDFILNR
560 570 580 590 600
FTIYDTLGEG TFGKVVRVND SLSDTFMALK IIKNVSKYRE AAKLEVKVLQ
610 620 630 640 650
KLAEKDPEKK NWVIHMGSYF DYNGHICLLF DLMGSSIFDF LKANHYKPYP
660 670 680 690 700
MEQTLHITWQ LCNAVKFLHD NKLTHTDLKP ENILFVDSRY TTKLVDKKPL
710 720 730 740 750
RVLHSTHVRL IDFGSATFDH EHHSIIVSTR HYRAPEVILE LGWSQPCDVW
760 770 780 790 800
SIGCILYELY TGVTLFQTHE NREHLAMMER VLGDIPLRMA KRTKTKFFIN
810 820 830 840 850
GRLDWVNTSA DAAYVRDNCK PLRRSMSCTD PEHVELFELI ENMLMFEPLA
860 870 880
RMKLPEALQH RYFNRLPENL KIPCKMDAST NPRINGD
Length:887
Mass (Da):96,910
Last modified:December 14, 2011 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i58DB91BC2CAE6C76
GO
Isoform bImported (identifier: G5EDB2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-512: MPILHQKIAS...ARKPSRSGLQ → MIANSKTIKIVNKKQAAISRPRVPIVPHQRTPIP

Show »
Length:409
Mass (Da):47,384
Checksum:iF13B36AA9CBA97AE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3B1DR12A0A3B1DR12_CAEEL
Probable dual specificity protein k...
madd-3 CELE_E02H4.3, E02H4.3
593Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B1E657A0A3B1E657_CAEEL
Probable dual specificity protein k...
madd-3 CELE_E02H4.3, E02H4.3
890Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B1E026A0A3B1E026_CAEEL
Probable dual specificity protein k...
madd-3 CELE_E02H4.3, E02H4.3
272Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B1E4Y4A0A3B1E4Y4_CAEEL
Probable dual specificity protein k...
madd-3 CELE_E02H4.3, E02H4.3
275Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0592281 – 512MPILH…RSGLQ → MIANSKTIKIVNKKQAAISR PRVPIVPHQRTPIP in isoform b. CuratedAdd BLAST512

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BX284606 Genomic DNA Translation: CAA91979.2
BX284606 Genomic DNA Translation: CAD44105.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T19209

NCBI Reference Sequences

More...
RefSeqi
NP_741927.1, NM_171798.1
NP_741928.1, NM_171799.4 [G5EDB2-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
E02H4.3a.1; E02H4.3a.1; WBGene00006517 [G5EDB2-1]
E02H4.3b.1; E02H4.3b.1; WBGene00006517

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3565068

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX284606 Genomic DNA Translation: CAA91979.2
BX284606 Genomic DNA Translation: CAD44105.1
PIRiT19209
RefSeqiNP_741927.1, NM_171798.1
NP_741928.1, NM_171799.4 [G5EDB2-1]

3D structure databases

SMRiG5EDB2
ModBaseiSearch...

Protein-protein interaction databases

STRINGi6239.E02H4.3a

Proteomic databases

EPDiG5EDB2
PaxDbiG5EDB2
PeptideAtlasiG5EDB2

Genome annotation databases

EnsemblMetazoaiE02H4.3a.1; E02H4.3a.1; WBGene00006517 [G5EDB2-1]
E02H4.3b.1; E02H4.3b.1; WBGene00006517
GeneIDi3565068

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3565068
WormBaseiE02H4.3a ; CE31462 ; WBGene00006517 ; madd-3
E02H4.3b ; CE52798 ; WBGene00006517 ; madd-3

Phylogenomic databases

eggNOGiKOG0671 Eukaryota
ENOG410XQF2 LUCA
GeneTreeiENSGT00940000154947
InParanoidiG5EDB2
OMAiKIKHASP
OrthoDBi290680at2759

Enzyme and pathway databases

SignaLinkiG5EDB2

Miscellaneous databases

Protein Ontology

More...
PROi
PR:G5EDB2

Gene expression databases

BgeeiWBGene00006517 Expressed in 5 organ(s), highest expression level in multi-cellular organism

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMADD3_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: G5EDB2
Secondary accession number(s): G5EGK0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2017
Last sequence update: December 14, 2011
Last modified: October 16, 2019
This is version 62 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again