Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gamma-tubulin complex component 6

Gene

Tubgcp6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome.By similarity

GO - Molecular functioni

  • gamma-tubulin binding Source: GO_Central
  • microtubule binding Source: MGI
  • structural constituent of cytoskeleton Source: GO_Central

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-MMU-380270 Recruitment of mitotic centrosome proteins and complexes
R-MMU-380320 Recruitment of NuMA to mitotic centrosomes

Names & Taxonomyi

Protein namesi
Recommended name:
Gamma-tubulin complex component 6
Short name:
GCP-6
Gene namesi
Name:Tubgcp6
Synonyms:Kiaa1669
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:2146071 Tubgcp6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004361641 – 1769Gamma-tubulin complex component 6Add BLAST1769

Proteomic databases

MaxQBiG5E8P0
PaxDbiG5E8P0
PRIDEiG5E8P0

PTM databases

iPTMnetiG5E8P0
PhosphoSitePlusiG5E8P0

Expressioni

Gene expression databases

BgeeiENSMUSG00000051786 Expressed in 173 organ(s), highest expression level in cerebellum
ExpressionAtlasiG5E8P0 baseline and differential
GenevisibleiQ6PFC6 MM

Interactioni

Subunit structurei

Gamma-tubulin complex is composed of gamma-tubulin, TUBGCP2, TUBGCP3, TUBGCP4, TUBGCP5 and TUBGCP6.By similarity

GO - Molecular functioni

Protein-protein interaction databases

IntActiG5E8P0, 9 interactors
STRINGi10090.ENSMUSP00000104977

Structurei

3D structure databases

ProteinModelPortaliG5E8P0
SMRiG5E8P0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TUBGCP family.Curated

Phylogenomic databases

eggNOGiKOG2000 Eukaryota
ENOG410XQ5B LUCA
GeneTreeiENSGT00850000132278
HOGENOMiHOG000112703
HOVERGENiHBG031569
InParanoidiG5E8P0
KOiK16573
OMAiHASDAHI
OrthoDBiEOG091G0ABS
TreeFamiTF106321

Family and domain databases

InterProiView protein in InterPro
IPR007259 GCP
PANTHERiPTHR19302 PTHR19302, 1 hit
PfamiView protein in Pfam
PF04130 Spc97_Spc98, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: G5E8P0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASITQLFDD LCEALLPAAQ ARPGQRSVNR KRAKRSLKRV AYNALFANLF
60 70 80 90 100
QEDTHQRQPD SSKLPVKNKV LMLSFDLRVG GLGPEADRLE ELVEKLEAAP
110 120 130 140 150
DCPFVEVASV LDLLVQLAGS GPPQVLRRKR DYFFNNKHAG RNIPYSGYDC
160 170 180 190 200
YDLSVFEMDV RSFISGEENL CHHTVQEALQ VMEAAPGTGL PTVGLFSIGD
210 220 230 240 250
SCGDRFERDT RVSLFGALVH SRTYDMDVRL DLPPVPDSAD FSGLAIKVPQ
260 270 280 290 300
IVDQWEDEGF QSASNLTPDS QSEPSMTPDL DLWEAVLTYE ASKRRCWERI
310 320 330 340 350
GCPPGHREEP YLTEAGRDAF DRFCRLRHGE LQALSGGLLQ APKPVLVEES
360 370 380 390 400
ELVKDSLNVL LGVVSATFSL CRPTQAFVVE PGVHVSGASP ESISSILSEV
410 420 430 440 450
AEYGTCYTRL SHFSLQPVVG SLCSRGLVFQ AFTSGLRRYL QYYRACVLST
460 470 480 490 500
PPTLSLLTIG FLFKKLGRQL RYLAELCGVG TVSLATSGEP RAVFPTGVKL
510 520 530 540 550
LSYLYQEALD NCSNEHYPVL LSLLKTSCEP YTRFIHDWVY SGVFRDVYGE
560 570 580 590 600
FMIQVNHEYL SFRDKFYWTH GYVLISKEVE DCVPVFLKHI AHDVYVCGKT
610 620 630 640 650
INLLKLCCPR HYLCWSDVPV PRISVIFSLE ELKEIEKDCA VYVGRMERVA
660 670 680 690 700
RHSCISKEEK ELRMEIAKQE LIVHAREAAS RVLSELSDRQ MAEQIAQDTR
710 720 730 740 750
KREQFQRLKE QFVKDQERRL AARQEELDDD FSYARELRDR EKRLKALEEE
760 770 780 790 800
LERKARQALV DHYSKLSAEA ARREQKALWR IQRHRLESAR LRFLLEDQKC
810 820 830 840 850
IQEMLRDMEA QQPQEPPSVF PSTGSQVTST GPEHAGEGHS CDPGFTELHW
860 870 880 890 900
GCPSLPCAST PSVPKSATEG ADDSGAGPFS TGLSITDFLP VDSGEEQPVE
910 920 930 940 950
NTGVPFLEVA LQTICSDLSP VAPEPAALTA GGPQATQSEY DFNTILRPAM
960 970 980 990 1000
ATSLSPGPFQ DVQNSVDSDK QHLLGDMSTK VDSYIHDMQE TLPCPHPLSH
1010 1020 1030 1040 1050
ATPVEGSLQP VGQLLEHMSE TTVSTESHAS GMAPCQQLSI SRHVSDANIK
1060 1070 1080 1090 1100
VGDYMSDVAL PRPRWNVHGH VSEASIGVGE NMAEVAPSRP RWNVHGHVSD
1110 1120 1130 1140 1150
ASIKIGENMS DVAPSRTRWN IHGHVSDASI KVGENVSDVT PSRPRWNVHG
1160 1170 1180 1190 1200
HVSEASIKVG ENVSDVTPSR PRWNVHGHVS EASIKVGENV SDVTPSRPRW
1210 1220 1230 1240 1250
NVHGHVSDAS IRIGENVSDT DLDLQQRGCA QPPLILEEPL PEAEADLKPH
1260 1270 1280 1290 1300
QCPPAHVSEA VLGVEAQSPA LECGPQLPEK TKPTVCSGFG RTEEGSLQTK
1310 1320 1330 1340 1350
TLVAEPSMLG SGIPEEKGPG KSRDAEDLSP CLPSSSQEDT AVPSSPGPSD
1360 1370 1380 1390 1400
EVSNTEAEAR RWGKEQAYLT DLTKLYHLEQ YPDSYDSMSE PPVAHLVHHM
1410 1420 1430 1440 1450
LPRAFAFPVD PQVQSAVDES AVQLSELLTL PVLMKRSLMA PLAAHVSLVS
1460 1470 1480 1490 1500
KAAVDYFFVE LHLETHFEAL RHFLLMEDGE FAQSLSDLLF EKLGAGQTPG
1510 1520 1530 1540 1550
ELLNPLVLNS ILSKALQYSL HGDTPHASNL SFALKYLPEV FAPNAPDVLS
1560 1570 1580 1590 1600
CLELRYKVDW PLNIVITESC LNKYSGIFSF LLQLKLMMWT LKDICFHLKR
1610 1620 1630 1640 1650
TALVSHTAGS VQFRQLQLFK HEMQHFVKVI QGYIANQILH VSWCEFRARL
1660 1670 1680 1690 1700
AVVGDLEEIQ RAHAEYLHRA VFRGLLTEKA APVMNIIHSI FSLVLKFRSQ
1710 1720 1730 1740 1750
LISQNWGPAT GPRGAEHPNF PLMQQSYSTF KYYSHFLFKV VTKLVNRGYQ
1760
PHLEDFLLRI NFNNYYQDS
Length:1,769
Mass (Da):197,192
Last modified:December 14, 2011 - v1
Checksum:i556E139E9CAE51EE
GO
Isoform 2 (identifier: G5E8P0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     249-281: PQIVDQWEDEGFQSASNLTPDSQSEPSMTPDLD → VFLSLSVTLEVWKILLPGTVGKLLSKPQVSRQS
     282-1769: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:281
Mass (Da):31,107
Checksum:iD36783BFE0616813
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6W5U8F6W5U8_MOUSE
Gamma-tubulin complex component
Tubgcp6
139Annotation score:
F6X8A1F6X8A1_MOUSE
Gamma-tubulin complex component
Tubgcp6
128Annotation score:
F6ZAT3F6ZAT3_MOUSE
Gamma-tubulin complex component
Tubgcp6
293Annotation score:
E9Q6P4E9Q6P4_MOUSE
Gamma-tubulin complex component 6
Tubgcp6
1,761Annotation score:
F6YBF3F6YBF3_MOUSE
Gamma-tubulin complex component 6
Tubgcp6
40Annotation score:

Sequence cautioni

The sequence BAC98230 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_058269249 – 281PQIVD…TPDLD → VFLSLSVTLEVWKILLPGTV GKLLSKPQVSRQS in isoform 2. Add BLAST33
Alternative sequenceiVSP_058270282 – 1769Missing in isoform 2. Add BLAST1488

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129420 mRNA Translation: BAC98230.1 Different initiation.
AC113069 Genomic DNA No translation available.
CH466550 Genomic DNA Translation: EDL04376.1
AK052441 mRNA Translation: BAC34992.1
BC057626 mRNA Translation: AAH57626.1
CCDSiCCDS49697.1 [G5E8P0-1]
RefSeqiNP_001156791.1, NM_001163319.1 [G5E8P0-1]
UniGeneiMm.380934

Genome annotation databases

EnsembliENSMUST00000109353; ENSMUSP00000104977; ENSMUSG00000051786 [G5E8P0-1]
GeneIDi328580
KEGGimmu:328580
UCSCiuc007xfh.2 mouse [G5E8P0-1]
uc056yzw.1 mouse

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129420 mRNA Translation: BAC98230.1 Different initiation.
AC113069 Genomic DNA No translation available.
CH466550 Genomic DNA Translation: EDL04376.1
AK052441 mRNA Translation: BAC34992.1
BC057626 mRNA Translation: AAH57626.1
CCDSiCCDS49697.1 [G5E8P0-1]
RefSeqiNP_001156791.1, NM_001163319.1 [G5E8P0-1]
UniGeneiMm.380934

3D structure databases

ProteinModelPortaliG5E8P0
SMRiG5E8P0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiG5E8P0, 9 interactors
STRINGi10090.ENSMUSP00000104977

PTM databases

iPTMnetiG5E8P0
PhosphoSitePlusiG5E8P0

Proteomic databases

MaxQBiG5E8P0
PaxDbiG5E8P0
PRIDEiG5E8P0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000109353; ENSMUSP00000104977; ENSMUSG00000051786 [G5E8P0-1]
GeneIDi328580
KEGGimmu:328580
UCSCiuc007xfh.2 mouse [G5E8P0-1]
uc056yzw.1 mouse

Organism-specific databases

CTDi85378
MGIiMGI:2146071 Tubgcp6
RougeiSearch...

Phylogenomic databases

eggNOGiKOG2000 Eukaryota
ENOG410XQ5B LUCA
GeneTreeiENSGT00850000132278
HOGENOMiHOG000112703
HOVERGENiHBG031569
InParanoidiG5E8P0
KOiK16573
OMAiHASDAHI
OrthoDBiEOG091G0ABS
TreeFamiTF106321

Enzyme and pathway databases

ReactomeiR-MMU-380270 Recruitment of mitotic centrosome proteins and complexes
R-MMU-380320 Recruitment of NuMA to mitotic centrosomes

Miscellaneous databases

PROiPR:G5E8P0
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000051786 Expressed in 173 organ(s), highest expression level in cerebellum
ExpressionAtlasiG5E8P0 baseline and differential
GenevisibleiQ6PFC6 MM

Family and domain databases

InterProiView protein in InterPro
IPR007259 GCP
PANTHERiPTHR19302 PTHR19302, 1 hit
PfamiView protein in Pfam
PF04130 Spc97_Spc98, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGCP6_MOUSE
AccessioniPrimary (citable) accession number: G5E8P0
Secondary accession number(s): Q6PFC6, Q6ZPK3, Q8BWI2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 11, 2016
Last sequence update: December 14, 2011
Last modified: November 7, 2018
This is version 56 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again