Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gamma-tubulin complex component 6

Gene

Tubgcp6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • gamma-tubulin binding Source: GO_Central
  • microtubule binding Source: MGI
  • structural constituent of cytoskeleton Source: GO_Central

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-380270 Recruitment of mitotic centrosome proteins and complexes
R-MMU-380320 Recruitment of NuMA to mitotic centrosomes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Gamma-tubulin complex component 6
Short name:
GCP-6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tubgcp6
Synonyms:Kiaa1669
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2146071 Tubgcp6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004361641 – 1769Gamma-tubulin complex component 6Add BLAST1769

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
G5E8P0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
G5E8P0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
G5E8P0

PRoteomics IDEntifications database

More...
PRIDEi
G5E8P0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
G5E8P0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
G5E8P0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000051786 Expressed in 173 organ(s), highest expression level in cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
G5E8P0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6PFC6 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Gamma-tubulin complex is composed of gamma-tubulin, TUBGCP2, TUBGCP3, TUBGCP4, TUBGCP5 and TUBGCP6.By similarity

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
G5E8P0, 9 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000104977

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
G5E8P0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
G5E8P0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TUBGCP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2000 Eukaryota
ENOG410XQ5B LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157810

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112703

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG031569

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
G5E8P0

KEGG Orthology (KO)

More...
KOi
K16573

Identification of Orthologs from Complete Genome Data

More...
OMAi
HASDAHI

Database of Orthologous Groups

More...
OrthoDBi
110079at2759

TreeFam database of animal gene trees

More...
TreeFami
TF106321

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007259 GCP
IPR040457 GCP_C

The PANTHER Classification System

More...
PANTHERi
PTHR19302 PTHR19302, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04130 GCP_C_terminal, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: G5E8P0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASITQLFDD LCEALLPAAQ ARPGQRSVNR KRAKRSLKRV AYNALFANLF
60 70 80 90 100
QEDTHQRQPD SSKLPVKNKV LMLSFDLRVG GLGPEADRLE ELVEKLEAAP
110 120 130 140 150
DCPFVEVASV LDLLVQLAGS GPPQVLRRKR DYFFNNKHAG RNIPYSGYDC
160 170 180 190 200
YDLSVFEMDV RSFISGEENL CHHTVQEALQ VMEAAPGTGL PTVGLFSIGD
210 220 230 240 250
SCGDRFERDT RVSLFGALVH SRTYDMDVRL DLPPVPDSAD FSGLAIKVPQ
260 270 280 290 300
IVDQWEDEGF QSASNLTPDS QSEPSMTPDL DLWEAVLTYE ASKRRCWERI
310 320 330 340 350
GCPPGHREEP YLTEAGRDAF DRFCRLRHGE LQALSGGLLQ APKPVLVEES
360 370 380 390 400
ELVKDSLNVL LGVVSATFSL CRPTQAFVVE PGVHVSGASP ESISSILSEV
410 420 430 440 450
AEYGTCYTRL SHFSLQPVVG SLCSRGLVFQ AFTSGLRRYL QYYRACVLST
460 470 480 490 500
PPTLSLLTIG FLFKKLGRQL RYLAELCGVG TVSLATSGEP RAVFPTGVKL
510 520 530 540 550
LSYLYQEALD NCSNEHYPVL LSLLKTSCEP YTRFIHDWVY SGVFRDVYGE
560 570 580 590 600
FMIQVNHEYL SFRDKFYWTH GYVLISKEVE DCVPVFLKHI AHDVYVCGKT
610 620 630 640 650
INLLKLCCPR HYLCWSDVPV PRISVIFSLE ELKEIEKDCA VYVGRMERVA
660 670 680 690 700
RHSCISKEEK ELRMEIAKQE LIVHAREAAS RVLSELSDRQ MAEQIAQDTR
710 720 730 740 750
KREQFQRLKE QFVKDQERRL AARQEELDDD FSYARELRDR EKRLKALEEE
760 770 780 790 800
LERKARQALV DHYSKLSAEA ARREQKALWR IQRHRLESAR LRFLLEDQKC
810 820 830 840 850
IQEMLRDMEA QQPQEPPSVF PSTGSQVTST GPEHAGEGHS CDPGFTELHW
860 870 880 890 900
GCPSLPCAST PSVPKSATEG ADDSGAGPFS TGLSITDFLP VDSGEEQPVE
910 920 930 940 950
NTGVPFLEVA LQTICSDLSP VAPEPAALTA GGPQATQSEY DFNTILRPAM
960 970 980 990 1000
ATSLSPGPFQ DVQNSVDSDK QHLLGDMSTK VDSYIHDMQE TLPCPHPLSH
1010 1020 1030 1040 1050
ATPVEGSLQP VGQLLEHMSE TTVSTESHAS GMAPCQQLSI SRHVSDANIK
1060 1070 1080 1090 1100
VGDYMSDVAL PRPRWNVHGH VSEASIGVGE NMAEVAPSRP RWNVHGHVSD
1110 1120 1130 1140 1150
ASIKIGENMS DVAPSRTRWN IHGHVSDASI KVGENVSDVT PSRPRWNVHG
1160 1170 1180 1190 1200
HVSEASIKVG ENVSDVTPSR PRWNVHGHVS EASIKVGENV SDVTPSRPRW
1210 1220 1230 1240 1250
NVHGHVSDAS IRIGENVSDT DLDLQQRGCA QPPLILEEPL PEAEADLKPH
1260 1270 1280 1290 1300
QCPPAHVSEA VLGVEAQSPA LECGPQLPEK TKPTVCSGFG RTEEGSLQTK
1310 1320 1330 1340 1350
TLVAEPSMLG SGIPEEKGPG KSRDAEDLSP CLPSSSQEDT AVPSSPGPSD
1360 1370 1380 1390 1400
EVSNTEAEAR RWGKEQAYLT DLTKLYHLEQ YPDSYDSMSE PPVAHLVHHM
1410 1420 1430 1440 1450
LPRAFAFPVD PQVQSAVDES AVQLSELLTL PVLMKRSLMA PLAAHVSLVS
1460 1470 1480 1490 1500
KAAVDYFFVE LHLETHFEAL RHFLLMEDGE FAQSLSDLLF EKLGAGQTPG
1510 1520 1530 1540 1550
ELLNPLVLNS ILSKALQYSL HGDTPHASNL SFALKYLPEV FAPNAPDVLS
1560 1570 1580 1590 1600
CLELRYKVDW PLNIVITESC LNKYSGIFSF LLQLKLMMWT LKDICFHLKR
1610 1620 1630 1640 1650
TALVSHTAGS VQFRQLQLFK HEMQHFVKVI QGYIANQILH VSWCEFRARL
1660 1670 1680 1690 1700
AVVGDLEEIQ RAHAEYLHRA VFRGLLTEKA APVMNIIHSI FSLVLKFRSQ
1710 1720 1730 1740 1750
LISQNWGPAT GPRGAEHPNF PLMQQSYSTF KYYSHFLFKV VTKLVNRGYQ
1760
PHLEDFLLRI NFNNYYQDS
Length:1,769
Mass (Da):197,192
Last modified:December 14, 2011 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i556E139E9CAE51EE
GO
Isoform 2 (identifier: G5E8P0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     249-281: PQIVDQWEDEGFQSASNLTPDSQSEPSMTPDLD → VFLSLSVTLEVWKILLPGTVGKLLSKPQVSRQS
     282-1769: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:281
Mass (Da):31,107
Checksum:iD36783BFE0616813
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6W5U8F6W5U8_MOUSE
Gamma-tubulin complex component
Tubgcp6
139Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6X8A1F6X8A1_MOUSE
Gamma-tubulin complex component
Tubgcp6
128Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6ZAT3F6ZAT3_MOUSE
Gamma-tubulin complex component
Tubgcp6
293Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q6P4E9Q6P4_MOUSE
Gamma-tubulin complex component 6
Tubgcp6
1,761Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6YBF3F6YBF3_MOUSE
Gamma-tubulin complex component 6
Tubgcp6
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC98230 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_058269249 – 281PQIVD…TPDLD → VFLSLSVTLEVWKILLPGTV GKLLSKPQVSRQS in isoform 2. Add BLAST33
Alternative sequenceiVSP_058270282 – 1769Missing in isoform 2. Add BLAST1488

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK129420 mRNA Translation: BAC98230.1 Different initiation.
AC113069 Genomic DNA No translation available.
CH466550 Genomic DNA Translation: EDL04376.1
AK052441 mRNA Translation: BAC34992.1
BC057626 mRNA Translation: AAH57626.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS49697.1 [G5E8P0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001156791.1, NM_001163319.1 [G5E8P0-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.380934

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000109353; ENSMUSP00000104977; ENSMUSG00000051786 [G5E8P0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
328580

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:328580

UCSC genome browser

More...
UCSCi
uc007xfh.2 mouse [G5E8P0-1]
uc056yzw.1 mouse

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129420 mRNA Translation: BAC98230.1 Different initiation.
AC113069 Genomic DNA No translation available.
CH466550 Genomic DNA Translation: EDL04376.1
AK052441 mRNA Translation: BAC34992.1
BC057626 mRNA Translation: AAH57626.1
CCDSiCCDS49697.1 [G5E8P0-1]
RefSeqiNP_001156791.1, NM_001163319.1 [G5E8P0-1]
UniGeneiMm.380934

3D structure databases

ProteinModelPortaliG5E8P0
SMRiG5E8P0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiG5E8P0, 9 interactors
STRINGi10090.ENSMUSP00000104977

PTM databases

iPTMnetiG5E8P0
PhosphoSitePlusiG5E8P0

Proteomic databases

jPOSTiG5E8P0
MaxQBiG5E8P0
PaxDbiG5E8P0
PRIDEiG5E8P0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000109353; ENSMUSP00000104977; ENSMUSG00000051786 [G5E8P0-1]
GeneIDi328580
KEGGimmu:328580
UCSCiuc007xfh.2 mouse [G5E8P0-1]
uc056yzw.1 mouse

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
85378
MGIiMGI:2146071 Tubgcp6

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG2000 Eukaryota
ENOG410XQ5B LUCA
GeneTreeiENSGT00940000157810
HOGENOMiHOG000112703
HOVERGENiHBG031569
InParanoidiG5E8P0
KOiK16573
OMAiHASDAHI
OrthoDBi110079at2759
TreeFamiTF106321

Enzyme and pathway databases

ReactomeiR-MMU-380270 Recruitment of mitotic centrosome proteins and complexes
R-MMU-380320 Recruitment of NuMA to mitotic centrosomes

Miscellaneous databases

Protein Ontology

More...
PROi
PR:G5E8P0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000051786 Expressed in 173 organ(s), highest expression level in cerebellum
ExpressionAtlasiG5E8P0 baseline and differential
GenevisibleiQ6PFC6 MM

Family and domain databases

InterProiView protein in InterPro
IPR007259 GCP
IPR040457 GCP_C
PANTHERiPTHR19302 PTHR19302, 1 hit
PfamiView protein in Pfam
PF04130 GCP_C_terminal, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGCP6_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: G5E8P0
Secondary accession number(s): Q6PFC6, Q6ZPK3, Q8BWI2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 11, 2016
Last sequence update: December 14, 2011
Last modified: January 16, 2019
This is version 58 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again