Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin-3

Gene

Ank3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments (By similarity). In skeletal muscle, required for costamere localization of DMD and betaDAG1. Regulates KCNA1 channel activity in function of dietary Mg2+ levels, and thereby contributes to the regulation of renal Mg2+ reabsorption (PubMed:23903368).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-445095 Interaction between L1 and Ankyrins
R-MMU-6807878 COPI-mediated anterograde transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin-3
Short name:
ANK-3
Alternative name(s):
Ankyrin-G
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ank3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:88026 Ank3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Lysosome, Membrane, Postsynaptic cell membrane, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004197821 – 1961Ankyrin-3Add BLAST1961

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei22PhosphoserineBy similarity1
Modified residuei606PhosphoserineBy similarity1
Modified residuei830PhosphoserineCombined sources1
Modified residuei844PhosphoserineBy similarity1
Modified residuei850PhosphoserineCombined sources1
Modified residuei873PhosphoserineCombined sources1
Modified residuei914PhosphoserineBy similarity1
Modified residuei917PhosphoserineBy similarity1
Modified residuei923PhosphoserineCombined sources1
Modified residuei958PhosphoserineBy similarity1
Modified residuei960PhosphoserineBy similarity1
Modified residuei1114PhosphoserineCombined sources1
Modified residuei1451PhosphoserineCombined sources1
Modified residuei1462PhosphoserineCombined sources1
Modified residuei1470PhosphoserineCombined sources1
Modified residuei1473PhosphoserineCombined sources1
Modified residuei1795PhosphoserineCombined sources1
Modified residuei1813PhosphoserineBy similarity1
Modified residuei1883PhosphoserineBy similarity1
Isoform 6 (identifier: G5E8K5-6)
Modified residuei732PhosphoserineCombined sources1
Isoform 2 (identifier: G5E8K5-2)
Modified residuei830PhosphoserineCombined sources1
Modified residuei1560PhosphoserineCombined sources1
Isoform 3 (identifier: G5E8K5-3)
Modified residuei830PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
G5E8K5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
G5E8K5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
G5E8K5

PRoteomics IDEntifications database

More...
PRIDEi
G5E8K5

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
G5E8K5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
G5E8K5

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
G5E8K5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in many epithelial tissues, muscles and axons. Expressed in kidney, brain, skin, lung, liver, intestine, pancreas, heart and testis (at protein level). In testis, expressed in Leydig cells, but very weakly or not at all in Sertoli cells or seminiferous tubules. Expressed in macrophages (at protein level).3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

In an in vitro model of myogenesis, not detected in proliferating myoblasts. Hardly detectable during the first days of differentiation. Expression greatly increases in mature myotubes.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by high dietary Mg2+ levels.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000069601 Expressed in 286 organ(s), highest expression level in ventral horn of spinal cord

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
G5E8K5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
G5E8K5 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

May be a constituent of a NFASC/NRCAM/ankyrin G complex. Interacts with RHBG (By similarity). Directly interacts with DMD and betaDAG1; this interaction does not interfere with DMD-binding and is required for DMD and betaDAG1 retention at costameres. Interacts (via N-terminal ANK repeats) with SCHIP1 isoform 7 (via C-terminus); this interaction is required for the localization at axon initial segments (AISs) and nodes of Ranvier (NRs). Interacts with PLEC and FLNC (By similarity). Interacts with KCNA1; this inhibits channel activity (PubMed:23903368). Interacts with SCN5A (By similarity).By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
198102, 5 interactors

Protein interaction database and analysis system

More...
IntActi
G5E8K5, 9 interactors

Molecular INTeraction database

More...
MINTi
G5E8K5

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000090090

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
G5E8K5

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
G5E8K5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati56 – 85ANK 1Add BLAST30
Repeati89 – 118ANK 2Add BLAST30
Repeati122 – 151ANK 3Add BLAST30
Repeati155 – 184ANK 4Add BLAST30
Repeati186 – 213ANK 5Add BLAST28
Repeati217 – 246ANK 6Add BLAST30
Repeati250 – 279ANK 7Add BLAST30
Repeati283 – 312ANK 8Add BLAST30
Repeati316 – 345ANK 9Add BLAST30
Repeati349 – 378ANK 10Add BLAST30
Repeati382 – 411ANK 11Add BLAST30
Repeati415 – 444ANK 12Add BLAST30
Repeati448 – 477ANK 13Add BLAST30
Repeati481 – 510ANK 14Add BLAST30
Repeati514 – 543ANK 15Add BLAST30
Repeati547 – 576ANK 16Add BLAST30
Repeati580 – 609ANK 17Add BLAST30
Repeati613 – 642ANK 18Add BLAST30
Repeati646 – 675ANK 19Add BLAST30
Repeati679 – 708ANK 20Add BLAST30
Repeati712 – 741ANK 21Add BLAST30
Repeati745 – 774ANK 22Add BLAST30
Repeati778 – 807ANK 23Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini985 – 1140ZU5 1PROSITE-ProRule annotationAdd BLAST156
Domaini1142 – 1289ZU5 2PROSITE-ProRule annotationAdd BLAST148
Domaini1478 – 1562DeathPROSITE-ProRule annotationAdd BLAST85

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1274 – 1408UPA domainBy similarityAdd BLAST135

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4177 Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154939

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000012873

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004234

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
G5E8K5

KEGG Orthology (KO)

More...
KOi
K10380

Database of Orthologous Groups

More...
OrthoDBi
1011028at2759

TreeFam database of animal gene trees

More...
TreeFami
TF351263

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00204 ANK, 7 hits
cd08803 Death_ank3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR037971 Ank3_Death
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR011029 DEATH-like_dom_sf
IPR000488 Death_domain
IPR000906 ZU5_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00023 Ank, 1 hit
PF12796 Ank_2, 7 hits
PF13606 Ank_3, 1 hit
PF00531 Death, 1 hit
PF00791 ZU5, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01415 ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 22 hits
SM00005 DEATH, 1 hit
SM00218 ZU5, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47986 SSF47986, 1 hit
SSF48403 SSF48403, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 21 hits
PS50017 DEATH_DOMAIN, 1 hit
PS51145 ZU5, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 24 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: G5E8K5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEEPKEKPA KPAHRKRKGK KSDANASYLR AARAGHLEKA LDYIKNGVDV
60 70 80 90 100
NICNQNGLNA LHLASKEGHV EVVSELLQRE ANVDAATKKG NTALHIASLA
110 120 130 140 150
GQAEVVKVLV TNGANVNAQS QNGFTPLYMA AQENHLEVVR FLLDNGASQS
160 170 180 190 200
LATEDGFTPL AVALQQGHDQ VVSLLLENDT KGKVRLPALH IAARKDDTKA
210 220 230 240 250
AALLLQNDTN ADVESKSGFT PLHIAAHYGN INVATLLLNR AAAVDFTARN
260 270 280 290 300
DITPLHVASK RGNANMVKLL LDRGAKIDAK TRDGLTPLHC GARSGHEQVV
310 320 330 340 350
EMLLDRSAPI LSKTKNGLSP LHMATQGDHL NCVQLLLQHN VPVDDVTNDY
360 370 380 390 400
LTALHVAAHC GHYKVAKVLL DKKASPNAKA LNGFTPLHIA CKKNRIRVME
410 420 430 440 450
LLLKHGASIQ AVTESGLTPI HVAAFMGHVN IVSQLMHHGA SPNTTNVRGE
460 470 480 490 500
TALHMAARSG QAEVVRYLVQ DGAQVEAKAK DDQTPLHISA RLGKADIVQQ
510 520 530 540 550
LLQQGASPNA ATTSGYTPLH LAAREGHEDV AAFLLDHGAS LSITTKKGFT
560 570 580 590 600
PLHVAAKYGK LEVASLLLQK SASPDAAGKS GLTPLHVAAH YDNQKVALLL
610 620 630 640 650
LDQGASPHAA AKNGYTPLHI AAKKNQMDIA TSLLEYGADA NAVTRQGIAS
660 670 680 690 700
VHLAAQEGHV DMVSLLLSRN ANVNLSNKSG LTPLHLAAQE DRVNVAEVLV
710 720 730 740 750
NQGAHVDAQT KMGYTPLHVG CHYGNIKIVN FLLQHSAKVN AKTKNGYTAL
760 770 780 790 800
HQAAQQGHTH IINVLLQNNA SPNELTVNGN TALAIARRLG YISVVDTLKV
810 820 830 840 850
VTEEIMTTTT ITEKHKMNVP ETMNEVLDMS DDEVRKASAP EKLSDGEYIS
860 870 880 890 900
DGEEGDKCTW FKIPKVQEVL VKSEDAITGD TDKYLGPQDL KELGDDSLPA
910 920 930 940 950
EGYVGFSLGA RSASLRSFSS DRSYTLNRSS YARDSMMIEE LLVPSKEQHL
960 970 980 990 1000
TFTREFDSDS LRHYSWAADT LDNVNLVSSP VHSGFLVSFM VDARGGSMRG
1010 1020 1030 1040 1050
SRHHGMRIII PPRKCTAPTR ITCRLVKRHK LANPPPMVEG EGLASRLVEM
1060 1070 1080 1090 1100
GPAGAQFLGP VIVEIPHFGS MRGKERELIV LRSENGETWK EHQFDSKNED
1110 1120 1130 1140 1150
LAELLNGMDE ELDSPEELGT KRICRIITKD FPQYFAVVSR IKQESNQIGP
1160 1170 1180 1190 1200
EGGILSSTTV PLVQASFPEG ALTKRIRVGL QAQPVPEETV KKILGNKATF
1210 1220 1230 1240 1250
SPIVTVEPRR RKFHKPITMT IPVPPPSGEG VSNGYKGDAT PNLRLLCSIT
1260 1270 1280 1290 1300
GGTSPAQWED ITGTTPLTFI KDCVSFTTNV SARFWLADCH QVLETVGLAS
1310 1320 1330 1340 1350
QLYRELICVP YMAKFVVFAK TNDPVESSLR CFCMTDDRVD KTLEQQENFE
1360 1370 1380 1390 1400
EVARSKDIEV LEGKPIYVDC YGNLAPLTKG GQQLVFNFYS FKENRLPFSI
1410 1420 1430 1440 1450
KIRDTSQEPC GRLSFLKEPK TTKGLPQTAV CNLNITLPAH KKAEKADRRQ
1460 1470 1480 1490 1500
SFASLALRKR YSYLTEPSMS PQSPCERTDI RMAIVADHLG LSWTELAREL
1510 1520 1530 1540 1550
NFSVDEINQI RVENPNSLIS QSFMLLKKWV TRDGKNATTD ALTSVLTKIN
1560 1570 1580 1590 1600
RIDIVTLLEG PIFDYGNISG TRSFADENNV FHDPVDGHPS FQVELETPMG
1610 1620 1630 1640 1650
LYCTPPNPFQ QDDHFSDISS IESPFRTPSR LSDGLVPSQG NIEHPTGGPP
1660 1670 1680 1690 1700
VVTAEDTSLE DSKMDDSVTV TDPADPLDVD ESQLKDLCQS ECAQCWASVP
1710 1720 1730 1740 1750
GIPNDGRQAE PLRPQTRKVG MSSEQQEKGK SGPDEEVTED KVKSLFEDIQ
1760 1770 1780 1790 1800
LEEVEAEEMT EDQGQAMLNR VQRAELAMSS LAGWQNETPS GSLESPAQAR
1810 1820 1830 1840 1850
RLTGGLLDRL DDSSDQARDS ITSYLTGEPG KIEANGNHTA EVIPEAKAKP
1860 1870 1880 1890 1900
YFPESQNDIG KQSIKENLKP KTHGCGRTEE PVSPLTAYQK SLEETSKLVI
1910 1920 1930 1940 1950
EDAPKPCVPV GMKKMTRTTA DGKARLNLQE EEGSTRSEPK QGEGYKVKTK
1960
KEIRNVEKKT H
Length:1,961
Mass (Da):214,062
Last modified:December 14, 2011 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i58F91B5BF87867CE
GO
Isoform 2 (identifier: G5E8K5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     834-873: VRKASAPEKLSDGEYISDGEEGDKCTWFKIPKVQEVLVKS → G
     1588-1783: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:1,726
Mass (Da):188,256
Checksum:i330058F77E15E49F
GO
Isoform 3 (identifier: G5E8K5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     834-873: VRKASAPEKLSDGEYISDGEEGDKCTWFKIPKVQEVLVKS → G

Show »
Length:1,922
Mass (Da):209,669
Checksum:i7A4B65429B20B8F2
GO
Isoform 4 (identifier: G5E8K5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-867: Missing.
     868-872: EVLVK → MALPH

Note: No experimental confirmation available.
Show »
Length:1,094
Mass (Da):121,205
Checksum:i5D9DA021B66D5BC2
GO
Isoform 5 (identifier: G5E8K5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-867: Missing.
     868-872: EVLVK → MALPH
     1941-1941: Missing.

Show »
Length:1,093
Mass (Da):121,077
Checksum:i339712E963046146
GO
Isoform 6 (identifier: G5E8K5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-867: Missing.
     868-872: EVLVK → MALPH
     1588-1783: Missing.

Show »
Length:898
Mass (Da):99,791
Checksum:i97A7901C8A0DAD67
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 24 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R2K9S4R2K9_MOUSE
Ankyrin-3
Ank3
2,622Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R2S8S4R2S8_MOUSE
Ankyrin-3
Ank3
1,985Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E8K3G5E8K3_MOUSE
Ankyrin 3, epithelial, isoform CRA_...
Ank3 mCG_14429
1,943Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E8K2G5E8K2_MOUSE
Ankyrin 3, epithelial, isoform CRA_...
Ank3 mCG_14429
1,940Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R236S4R236_MOUSE
Ankyrin-3
Ank3
1,181Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R1S2S4R1S2_MOUSE
Ankyrin-3
Ank3
1,807Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R165S4R165_MOUSE
Ankyrin-3
Ank3
1,174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R2J6S4R2J6_MOUSE
Ankyrin-3
Ank3
1,157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P812A0A1W2P812_MOUSE
Ankyrin-3
Ank3
1,758Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WNU5A0A087WNU5_MOUSE
Ankyrin-3
Ank3
2,871Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB58380 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAB58381 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti717L → P in AAH21657 (PubMed:15489334).Curated1
Sequence conflicti1603C → W in AAB01607 (PubMed:7615634).Curated1
Sequence conflicti1603C → W in AAB01603 (PubMed:7615634).Curated1
Sequence conflicti1603C → W in AAB58381 (PubMed:15489334).Curated1
Sequence conflicti1652V → I in BAC29151 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0443551 – 867Missing in isoform 4, isoform 5 and isoform 6. 2 PublicationsAdd BLAST867
Alternative sequenceiVSP_044356834 – 873VRKAS…VLVKS → G in isoform 2 and isoform 3. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_044357868 – 872EVLVK → MALPH in isoform 4, isoform 5 and isoform 6. 2 Publications5
Alternative sequenceiVSP_0443581588 – 1783Missing in isoform 2 and isoform 6. 3 PublicationsAdd BLAST196
Alternative sequenceiVSP_0443591941Missing in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L40631 mRNA Translation: AAB01602.1
L40631 mRNA Translation: AAB01603.1
L40632 mRNA Translation: AAB01607.1
AK035681 mRNA Translation: BAC29151.1
AK162007 mRNA Translation: BAE36677.1
AC100427 Genomic DNA No translation available.
AC129018 Genomic DNA No translation available.
AC132435 Genomic DNA No translation available.
AC156836 Genomic DNA No translation available.
CH466553 Genomic DNA Translation: EDL31985.1
CH466553 Genomic DNA Translation: EDL31989.1
CH466553 Genomic DNA Translation: EDL31990.1
BC021657 mRNA Translation: AAH21657.1
U89274 mRNA Translation: AAB58380.1 Different initiation.
U89275 mRNA Translation: AAB58381.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS23909.1 [G5E8K5-1]
CCDS23912.1 [G5E8K5-4]
CCDS35931.1 [G5E8K5-3]
CCDS59545.1 [G5E8K5-2]
CCDS59546.1 [G5E8K5-6]

NCBI Reference Sequences

More...
RefSeqi
NP_033800.2, NM_009670.4 [G5E8K5-6]
NP_666117.2, NM_146005.3 [G5E8K5-1]
NP_733788.2, NM_170687.3 [G5E8K5-4]
NP_733789.1, NM_170688.2
NP_733790.2, NM_170689.2
NP_733791.2, NM_170690.2
NP_733924.2, NM_170728.2 [G5E8K5-2]
NP_733925.2, NM_170729.2 [G5E8K5-3]
NP_733926.2, NM_170730.2
XP_006513202.1, XM_006513139.3 [G5E8K5-5]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.235960

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000054167; ENSMUSP00000061698; ENSMUSG00000069601 [G5E8K5-3]
ENSMUST00000092433; ENSMUSP00000090089; ENSMUSG00000069601 [G5E8K5-4]
ENSMUST00000092434; ENSMUSP00000090090; ENSMUSG00000069601 [G5E8K5-1]
ENSMUST00000181974; ENSMUSP00000138285; ENSMUSG00000069601 [G5E8K5-6]
ENSMUST00000182029; ENSMUSP00000138337; ENSMUSG00000069601 [G5E8K5-5]
ENSMUST00000182155; ENSMUSP00000138347; ENSMUSG00000069601 [G5E8K5-2]
ENSMUST00000182884; ENSMUSP00000138326; ENSMUSG00000069601 [G5E8K5-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11735

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:11735

UCSC genome browser

More...
UCSCi
uc007fmw.1 mouse [G5E8K5-1]
uc007fna.1 mouse [G5E8K5-2]
uc007fnb.1 mouse [G5E8K5-3]
uc007fnh.1 mouse [G5E8K5-6]
uc007fni.1 mouse [G5E8K5-5]
uc007fnk.1 mouse [G5E8K5-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L40631 mRNA Translation: AAB01602.1
L40631 mRNA Translation: AAB01603.1
L40632 mRNA Translation: AAB01607.1
AK035681 mRNA Translation: BAC29151.1
AK162007 mRNA Translation: BAE36677.1
AC100427 Genomic DNA No translation available.
AC129018 Genomic DNA No translation available.
AC132435 Genomic DNA No translation available.
AC156836 Genomic DNA No translation available.
CH466553 Genomic DNA Translation: EDL31985.1
CH466553 Genomic DNA Translation: EDL31989.1
CH466553 Genomic DNA Translation: EDL31990.1
BC021657 mRNA Translation: AAH21657.1
U89274 mRNA Translation: AAB58380.1 Different initiation.
U89275 mRNA Translation: AAB58381.1 Different initiation.
CCDSiCCDS23909.1 [G5E8K5-1]
CCDS23912.1 [G5E8K5-4]
CCDS35931.1 [G5E8K5-3]
CCDS59545.1 [G5E8K5-2]
CCDS59546.1 [G5E8K5-6]
RefSeqiNP_033800.2, NM_009670.4 [G5E8K5-6]
NP_666117.2, NM_146005.3 [G5E8K5-1]
NP_733788.2, NM_170687.3 [G5E8K5-4]
NP_733789.1, NM_170688.2
NP_733790.2, NM_170689.2
NP_733791.2, NM_170690.2
NP_733924.2, NM_170728.2 [G5E8K5-2]
NP_733925.2, NM_170729.2 [G5E8K5-3]
NP_733926.2, NM_170730.2
XP_006513202.1, XM_006513139.3 [G5E8K5-5]
UniGeneiMm.235960

3D structure databases

ProteinModelPortaliG5E8K5
SMRiG5E8K5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198102, 5 interactors
IntActiG5E8K5, 9 interactors
MINTiG5E8K5
STRINGi10090.ENSMUSP00000090090

PTM databases

iPTMnetiG5E8K5
PhosphoSitePlusiG5E8K5
SwissPalmiG5E8K5

Proteomic databases

jPOSTiG5E8K5
MaxQBiG5E8K5
PaxDbiG5E8K5
PRIDEiG5E8K5

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000054167; ENSMUSP00000061698; ENSMUSG00000069601 [G5E8K5-3]
ENSMUST00000092433; ENSMUSP00000090089; ENSMUSG00000069601 [G5E8K5-4]
ENSMUST00000092434; ENSMUSP00000090090; ENSMUSG00000069601 [G5E8K5-1]
ENSMUST00000181974; ENSMUSP00000138285; ENSMUSG00000069601 [G5E8K5-6]
ENSMUST00000182029; ENSMUSP00000138337; ENSMUSG00000069601 [G5E8K5-5]
ENSMUST00000182155; ENSMUSP00000138347; ENSMUSG00000069601 [G5E8K5-2]
ENSMUST00000182884; ENSMUSP00000138326; ENSMUSG00000069601 [G5E8K5-1]
GeneIDi11735
KEGGimmu:11735
UCSCiuc007fmw.1 mouse [G5E8K5-1]
uc007fna.1 mouse [G5E8K5-2]
uc007fnb.1 mouse [G5E8K5-3]
uc007fnh.1 mouse [G5E8K5-6]
uc007fni.1 mouse [G5E8K5-5]
uc007fnk.1 mouse [G5E8K5-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
288
MGIiMGI:88026 Ank3

Phylogenomic databases

eggNOGiKOG4177 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00940000154939
HOGENOMiHOG000012873
HOVERGENiHBG004234
InParanoidiG5E8K5
KOiK10380
OrthoDBi1011028at2759
TreeFamiTF351263

Enzyme and pathway databases

ReactomeiR-MMU-445095 Interaction between L1 and Ankyrins
R-MMU-6807878 COPI-mediated anterograde transport

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ank3 mouse

Protein Ontology

More...
PROi
PR:G5E8K5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000069601 Expressed in 286 organ(s), highest expression level in ventral horn of spinal cord
ExpressionAtlasiG5E8K5 baseline and differential
GenevisibleiG5E8K5 MM

Family and domain databases

CDDicd00204 ANK, 7 hits
cd08803 Death_ank3, 1 hit
Gene3Di1.25.40.20, 3 hits
InterProiView protein in InterPro
IPR037971 Ank3_Death
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR011029 DEATH-like_dom_sf
IPR000488 Death_domain
IPR000906 ZU5_dom
PfamiView protein in Pfam
PF00023 Ank, 1 hit
PF12796 Ank_2, 7 hits
PF13606 Ank_3, 1 hit
PF00531 Death, 1 hit
PF00791 ZU5, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 22 hits
SM00005 DEATH, 1 hit
SM00218 ZU5, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
SSF48403 SSF48403, 3 hits
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 21 hits
PS50017 DEATH_DOMAIN, 1 hit
PS51145 ZU5, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANK3_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: G5E8K5
Secondary accession number(s): G5E8K4
, O08866, O08867, Q3TSJ8, Q4U205, Q4U206, Q4U256, Q4U260, Q61305, Q61306, Q61307, Q61308, Q61309, Q61310, Q8CBN3, Q8VC68
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2012
Last sequence update: December 14, 2011
Last modified: January 16, 2019
This is version 70 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again