Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 68 (16 Oct 2019)
Sequence version 1 (28 Jun 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Fructose-bisphosphate aldolase 4, cytosolic

Gene

FBA4

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Fructose-bisphosphate aldolase that plays a key role in glycolysis and gluconeogenesis.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: glycolysis

This protein is involved in step 4 of the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose.Curated
Proteins known to be involved in the 4 steps of the subpathway in this organism are:
  1. Phosphotransferase (AXX17_At4g33470), Hexokinase-4 (At3g20040), Hexokinase-1 (HXK1), Phosphotransferase (AXX17_At3g21380), Phosphotransferase (AXX17_At1g41900), Phosphotransferase (AXX17_At2g15190), Phosphotransferase (HKL1), Phosphotransferase (AXX17_At1g44660), Phosphotransferase (AXX17_At1g41910), Hexokinase-2 (HXK2), Phosphotransferase (AXX17_At4g43120), Phosphotransferase (HKL1), Phosphotransferase (HXK3), Hexokinase-like 1 protein (At1g47840), Hexokinase-3 (At1g50460), Phosphotransferase (At4g29130), Phosphotransferase (HXK2), Phosphotransferase (At1g47845), Probable hexokinase-like 2 protein (At4g37840)
  2. Glucose-6-phosphate isomerase (AXX17_At4g28500), Glucose-6-phosphate isomerase (MJB21.12), Glucose-6-phosphate isomerase (PGI1 (At4g24620)), Glucose-6-phosphate isomerase, cytosolic (PGIC), Glucose-6-phosphate isomerase (PGIC), Glucose-6-phosphate isomerase 1, chloroplastic (PGI1), Glucose-6-phosphate isomerase (AXX17_At5g40630)
  3. ATP-dependent 6-phosphofructokinase 1 (PFK1), ATP-dependent 6-phosphofructokinase (PFK), ATP-dependent 6-phosphofructokinase 5, chloroplastic (PFK5), ATP-dependent 6-phosphofructokinase 4, chloroplastic (PFK4), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta (PFP-BETA), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha (PFP-ALPHA), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha (PFP-ALPHA), ATP-dependent 6-phosphofructokinase (PFK), ATP-dependent 6-phosphofructokinase 2 (PFK2), ATP-dependent 6-phosphofructokinase (PFK), ATP-dependent 6-phosphofructokinase (PFK), ATP-dependent 6-phosphofructokinase (PFK), ATP-dependent 6-phosphofructokinase (PFK), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta (PFP-BETA), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 1 (PFP-ALPHA1), ATP-dependent 6-phosphofructokinase 6 (PFK6), ATP-dependent 6-phosphofructokinase (PFK), ATP-dependent 6-phosphofructokinase (PFK), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1 (PFP-BETA1), ATP-dependent 6-phosphofructokinase 7 (PFK7), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 2 (PFP-BETA2), ATP-dependent 6-phosphofructokinase 3 (PFK3), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 2 (PFP-ALPHA2), ATP-dependent 6-phosphofructokinase (PFK)
  4. Fructose-bisphosphate aldolase 5, cytosolic (FBA5), Fructose-bisphosphate aldolase (FBA6), Fructose-bisphosphate aldolase (AXX17_At3g47340), Fructose-bisphosphate aldolase (FBA1), Fructose-bisphosphate aldolase (FBA1), Fructose-bisphosphate aldolase (FBA4), Fructose-bisphosphate aldolase (AXX17_At2g16800), Fructose-bisphosphate aldolase (AXX17_At4g44320), Fructose-bisphosphate aldolase (AXX17_At5g03010), Fructose-bisphosphate aldolase (AXX17_At4g30610), Fructose-bisphosphate aldolase (FBA2), Fructose-bisphosphate aldolase 1, chloroplastic (FBA1), Fructose-bisphosphate aldolase (AXX17_At5g03010), Fructose-bisphosphate aldolase 8, cytosolic (FBA8), Fructose-bisphosphate aldolase 7, cytosolic (FBA7), Fructose-bisphosphate aldolase 3, chloroplastic (FBA3), Fructose-bisphosphate aldolase 6, cytosolic (FBA6), Fructose-bisphosphate aldolase (FBA7), Fructose-bisphosphate aldolase (AXX17_At2g00100), Fructose-bisphosphate aldolase (FBA7), Fructose-bisphosphate aldolase (AXX17_At4g30600), Fructose-bisphosphate aldolase 2, chloroplastic (FBA2), Fructose-bisphosphate aldolase (At2g21330), Fructose-bisphosphate aldolase (AXX17_At3g47340), Fructose-bisphosphate aldolase (AXX17_At5g03010), Fructose-bisphosphate aldolase (AXX17_At2g33200), Fructose-bisphosphate aldolase 4, cytosolic (FBA4)
This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei73SubstrateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei217Proton acceptorBy similarity1
Active sitei259Schiff-base intermediate with dihydroxyacetone-PBy similarity1
Binding sitei333SubstrateBy similarity1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei393Necessary for preference for fructose 1,6-bisphosphate over fructose 1-phosphateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLyase
Biological processGlycolysis
LigandSchiff base

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00109;UER00183

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Fructose-bisphosphate aldolase 4, cytosolicCurated (EC:4.1.2.13By similarity)
Short name:
AtFBA41 Publication
Alternative name(s):
Cytosolic aldolase 3Curated
Short name:
cAld3Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FBA41 Publication
Ordered Locus Names:At5g03690Imported
ORF Names:F17C15_110Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT5G03690

The Arabidopsis Information Resource

More...
TAIRi
locus:2144563 AT5G03690

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004372381 – 393Fructose-bisphosphate aldolase 4, cytosolicAdd BLAST393

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei207S-glutathionyl cysteine; transient; alternateBy similarity1
Modified residuei207S-nitrosocysteine; transient; alternateBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

S-glutathionylated at Cys-207.By similarity
S-nitrosylated at Cys-207.By similarity

Keywords - PTMi

Glutathionylation, S-nitrosylation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
F4KGQ0

PRoteomics IDEntifications database

More...
PRIDEi
F4KGQ0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
F4KGQ0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in flowers.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By glucose and fructose (PubMed:22561114). Induced by abiotic stresses (PubMed:22561114).1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
F4KGQ0 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer.

By similarity

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
F4KGQ0, 1 interactor

STRING: functional protein association networks

More...
STRINGi
3702.AT5G03690.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
F4KGQ0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni301 – 303Substrate bindingBy similarity3

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1557 Eukaryota
COG3588 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000220876

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
F4KGQ0

KEGG Orthology (KO)

More...
KOi
K01623

Identification of Orthologs from Complete Genome Data

More...
OMAi
RRQFRQI

Database of Orthologous Groups

More...
OrthoDBi
799973at2759

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.20.20.70, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029768 Aldolase_I_AS
IPR013785 Aldolase_TIM
IPR000741 FBA_I

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00274 Glycolytic, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00158 ALDOLASE_CLASS_I, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: F4KGQ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSCFKSKFAG KSYFRRTFHS SIIQFHPQLS ILIWHRRYSI IRTYELIANA
60 70 80 90 100
AYIGTPGKGI LAADESTGTI GKRFVSINVE NVESNRRALR ELLFTTPGAL
110 120 130 140 150
QYISGIILFE ETLYQKTASG KLFVDVMKEA GVLPGIKVDK GTVELAGTNG
160 170 180 190 200
ETTTTGLDGL GDRCKKYYEA GARFAKWRAV LKIGNNEPSE LAIHENAYGL
210 220 230 240 250
ARYAVICQEN GLVPIVEPEI LVDGSHDIEK CAYVTERVLA ACYKALSDHH
260 270 280 290 300
VILEGTLLKP NMVTPGSDSG SKVKPEVIAK HTVRALQRTV PAAVPAVVFL
310 320 330 340 350
SGGQSEEEAT VNLNAINQLK GKKPWSLTFS YGRALQQSTL KAWGGKEENV
360 370 380 390
DKAQKAFLAR AKANSEATLG GYKGDAQLGE GASESLHVKD YKY
Length:393
Mass (Da):42,906
Last modified:June 28, 2011 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1D6045A5723A1982
GO
Isoform 2 (identifier: F4KGQ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-44: GKSYFRRTFHSSIIQFHPQLSILIWHRRYSIIRTY → D

Note: No experimental confirmation available.Curated
Show »
Length:359
Mass (Da):38,630
Checksum:iA22A64268A7D757B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1P8BBB5A0A1P8BBB5_ARATH
Fructose-bisphosphate aldolase
FBA4 AtFBA4, At5g03690, F17C15.110, F17C15_110
267Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti23I → V in AAM62481 (Ref. 4) Curated1
Sequence conflicti155T → I in AAM62481 (Ref. 4) Curated1
Sequence conflicti211G → R in AAM62481 (Ref. 4) Curated1
Sequence conflicti287Q → R in AAL32644 (PubMed:14593172).Curated1
Sequence conflicti287Q → R in AAM13358 (PubMed:14593172).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05850310 – 44GKSYF…IIRTY → D in isoform 2. Add BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL162506 Genomic DNA Translation: CAB82934.1
CP002688 Genomic DNA Translation: AED90642.1
CP002688 Genomic DNA Translation: AED90643.1
AY062566 mRNA Translation: AAL32644.1
AY093359 mRNA Translation: AAM13358.1
AY085249 mRNA Translation: AAM62481.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T48396

NCBI Reference Sequences

More...
RefSeqi
NP_568127.1, NM_120450.3 [F4KGQ0-1]
NP_850759.1, NM_180428.2 [F4KGQ0-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT5G03690.1; AT5G03690.1; AT5G03690 [F4KGQ0-1]
AT5G03690.2; AT5G03690.2; AT5G03690 [F4KGQ0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
831759

Gramene; a comparative resource for plants

More...
Gramenei
AT5G03690.1; AT5G03690.1; AT5G03690 [F4KGQ0-1]
AT5G03690.2; AT5G03690.2; AT5G03690 [F4KGQ0-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT5G03690

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL162506 Genomic DNA Translation: CAB82934.1
CP002688 Genomic DNA Translation: AED90642.1
CP002688 Genomic DNA Translation: AED90643.1
AY062566 mRNA Translation: AAL32644.1
AY093359 mRNA Translation: AAM13358.1
AY085249 mRNA Translation: AAM62481.1
PIRiT48396
RefSeqiNP_568127.1, NM_120450.3 [F4KGQ0-1]
NP_850759.1, NM_180428.2 [F4KGQ0-2]

3D structure databases

SMRiF4KGQ0
ModBaseiSearch...

Protein-protein interaction databases

IntActiF4KGQ0, 1 interactor
STRINGi3702.AT5G03690.1

PTM databases

iPTMnetiF4KGQ0

Proteomic databases

PaxDbiF4KGQ0
PRIDEiF4KGQ0

Genome annotation databases

EnsemblPlantsiAT5G03690.1; AT5G03690.1; AT5G03690 [F4KGQ0-1]
AT5G03690.2; AT5G03690.2; AT5G03690 [F4KGQ0-2]
GeneIDi831759
GrameneiAT5G03690.1; AT5G03690.1; AT5G03690 [F4KGQ0-1]
AT5G03690.2; AT5G03690.2; AT5G03690 [F4KGQ0-2]
KEGGiath:AT5G03690

Organism-specific databases

AraportiAT5G03690
TAIRilocus:2144563 AT5G03690

Phylogenomic databases

eggNOGiKOG1557 Eukaryota
COG3588 LUCA
HOGENOMiHOG000220876
InParanoidiF4KGQ0
KOiK01623
OMAiRRQFRQI
OrthoDBi799973at2759

Enzyme and pathway databases

UniPathwayiUPA00109;UER00183

Miscellaneous databases

Protein Ontology

More...
PROi
PR:F4KGQ0

Gene expression databases

ExpressionAtlasiF4KGQ0 baseline and differential

Family and domain databases

Gene3Di3.20.20.70, 1 hit
InterProiView protein in InterPro
IPR029768 Aldolase_I_AS
IPR013785 Aldolase_TIM
IPR000741 FBA_I
PfamiView protein in Pfam
PF00274 Glycolytic, 1 hit
PROSITEiView protein in PROSITE
PS00158 ALDOLASE_CLASS_I, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiALFC4_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: F4KGQ0
Secondary accession number(s): Q8LET3, Q8W4G8, Q9LZR9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 7, 2016
Last sequence update: June 28, 2011
Last modified: October 16, 2019
This is version 68 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again