Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fructose-bisphosphate aldolase 4, cytosolic

Gene

FBA4

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Fructose-bisphosphate aldolase that plays a key role in glycolysis and gluconeogenesis.By similarity

Catalytic activityi

D-fructose 1,6-bisphosphate = glycerone phosphate + D-glyceraldehyde 3-phosphate.By similarity

Pathwayi: glycolysis

This protein is involved in step 4 of the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose.Curated
Proteins known to be involved in the 4 steps of the subpathway in this organism are:
  1. no protein annotated in this organism
  2. Glucose-6-phosphate isomerase (MJB21.12), Glucose-6-phosphate isomerase (AXX17_At5g40630), Glucose-6-phosphate isomerase (PGI1 (At4g24620)), Glucose-6-phosphate isomerase, cytosolic (PGIC), Glucose-6-phosphate isomerase (AXX17_At4g28500), Glucose-6-phosphate isomerase 1, chloroplastic (PGI1), Glucose-6-phosphate isomerase (PGIC)
  3. ATP-dependent 6-phosphofructokinase 1 (PFK1), ATP-dependent 6-phosphofructokinase (PFK), ATP-dependent 6-phosphofructokinase (PFK), ATP-dependent 6-phosphofructokinase 3 (PFK3), ATP-dependent 6-phosphofructokinase 4, chloroplastic (PFK4), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha (PFP-ALPHA), ATP-dependent 6-phosphofructokinase 2 (PFK2), ATP-dependent 6-phosphofructokinase (PFK), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 2 (PFP-BETA2), ATP-dependent 6-phosphofructokinase 5, chloroplastic (PFK5), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha (PFP-ALPHA), ATP-dependent 6-phosphofructokinase (PFK), ATP-dependent 6-phosphofructokinase (PFK), ATP-dependent 6-phosphofructokinase (PFK), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 1 (PFP-ALPHA1), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta (PFP-BETA), ATP-dependent 6-phosphofructokinase 6 (PFK6), ATP-dependent 6-phosphofructokinase (PFK), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha 2 (PFP-ALPHA2), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta (PFP-BETA), Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1 (PFP-BETA1), ATP-dependent 6-phosphofructokinase (PFK), ATP-dependent 6-phosphofructokinase 7 (PFK7), ATP-dependent 6-phosphofructokinase (PFK)
  4. Fructose-bisphosphate aldolase 5, cytosolic (FBA5), Fructose-bisphosphate aldolase (FBA6), Fructose-bisphosphate aldolase (FBA4), Fructose-bisphosphate aldolase (AXX17_At4g44320), Fructose-bisphosphate aldolase (AXX17_At4g30610), Fructose-bisphosphate aldolase (FBA2), Fructose-bisphosphate aldolase 1, chloroplastic (FBA1), Fructose-bisphosphate aldolase (AXX17_At5g03010), Fructose-bisphosphate aldolase 7, cytosolic (FBA7), Fructose-bisphosphate aldolase 3, chloroplastic (FBA3), Fructose-bisphosphate aldolase 6, cytosolic (FBA6), Fructose-bisphosphate aldolase (FBA7), Fructose-bisphosphate aldolase (AXX17_At2g00100), Fructose-bisphosphate aldolase 2, chloroplastic (FBA2), Fructose-bisphosphate aldolase (At2g21330), Fructose-bisphosphate aldolase (AXX17_At2g33200), Fructose-bisphosphate aldolase (AXX17_At3g47340), Fructose-bisphosphate aldolase (FBA1), Fructose-bisphosphate aldolase (FBA1), Fructose-bisphosphate aldolase (AXX17_At2g16800), Fructose-bisphosphate aldolase (AXX17_At5g03010), Fructose-bisphosphate aldolase 8, cytosolic (FBA8), Fructose-bisphosphate aldolase (FBA7), Fructose-bisphosphate aldolase (AXX17_At4g30600), Fructose-bisphosphate aldolase (AXX17_At5g03010), Fructose-bisphosphate aldolase (AXX17_At3g47340), Fructose-bisphosphate aldolase 4, cytosolic (FBA4)
This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei73SubstrateBy similarity1
Active sitei217Proton acceptorBy similarity1
Active sitei259Schiff-base intermediate with dihydroxyacetone-PBy similarity1
Binding sitei333SubstrateBy similarity1
Sitei393Necessary for preference for fructose 1,6-bisphosphate over fructose 1-phosphateBy similarity1

GO - Molecular functioni

  • fructose-bisphosphate aldolase activity Source: UniProtKB

GO - Biological processi

  • gluconeogenesis Source: UniProtKB
  • glycolytic process Source: UniProtKB

Keywordsi

Molecular functionLyase
Biological processGlycolysis
LigandSchiff base

Enzyme and pathway databases

ReactomeiR-ATH-114608 Platelet degranulation
R-ATH-6798695 Neutrophil degranulation
R-ATH-70171 Glycolysis
R-ATH-70263 Gluconeogenesis
R-ATH-70350 Fructose catabolism
UniPathwayiUPA00109; UER00183

Names & Taxonomyi

Protein namesi
Recommended name:
Fructose-bisphosphate aldolase 4, cytosolicCurated (EC:4.1.2.13By similarity)
Short name:
AtFBA41 Publication
Alternative name(s):
Cytosolic aldolase 3Curated
Short name:
cAld3Curated
Gene namesi
Name:FBA41 Publication
Ordered Locus Names:At5g03690Imported
ORF Names:F17C15_110Imported
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 5

Organism-specific databases

AraportiAT5G03690
TAIRilocus:2144563 AT5G03690

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004372381 – 393Fructose-bisphosphate aldolase 4, cytosolicAdd BLAST393

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei207S-glutathionyl cysteine; transient; alternateBy similarity1
Modified residuei207S-nitrosocysteine; transient; alternateBy similarity1

Post-translational modificationi

S-glutathionylated at Cys-207.By similarity
S-nitrosylated at Cys-207.By similarity

Keywords - PTMi

Glutathionylation, S-nitrosylation

Proteomic databases

PaxDbiF4KGQ0
PRIDEiF4KGQ0

PTM databases

iPTMnetiF4KGQ0

Expressioni

Tissue specificityi

Highly expressed in flowers.1 Publication

Inductioni

By glucose and fructose (PubMed:22561114). Induced by abiotic stresses (PubMed:22561114).1 Publication

Gene expression databases

ExpressionAtlasiF4KGQ0 baseline and differential

Interactioni

Subunit structurei

Homotetramer.By similarity

Protein-protein interaction databases

IntActiF4KGQ0, 1 interactor
STRINGi3702.AT5G03690.1

Structurei

3D structure databases

ProteinModelPortaliF4KGQ0
SMRiF4KGQ0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni301 – 303Substrate bindingBy similarity3

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1557 Eukaryota
COG3588 LUCA
InParanoidiF4KGQ0
KOiK01623
OMAiDHDLKHC
OrthoDBiEOG09360ENE

Family and domain databases

Gene3Di3.20.20.70, 1 hit
InterProiView protein in InterPro
IPR029768 Aldolase_I_AS
IPR013785 Aldolase_TIM
IPR000741 FBA_I
PfamiView protein in Pfam
PF00274 Glycolytic, 1 hit
PROSITEiView protein in PROSITE
PS00158 ALDOLASE_CLASS_I, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: F4KGQ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSCFKSKFAG KSYFRRTFHS SIIQFHPQLS ILIWHRRYSI IRTYELIANA
60 70 80 90 100
AYIGTPGKGI LAADESTGTI GKRFVSINVE NVESNRRALR ELLFTTPGAL
110 120 130 140 150
QYISGIILFE ETLYQKTASG KLFVDVMKEA GVLPGIKVDK GTVELAGTNG
160 170 180 190 200
ETTTTGLDGL GDRCKKYYEA GARFAKWRAV LKIGNNEPSE LAIHENAYGL
210 220 230 240 250
ARYAVICQEN GLVPIVEPEI LVDGSHDIEK CAYVTERVLA ACYKALSDHH
260 270 280 290 300
VILEGTLLKP NMVTPGSDSG SKVKPEVIAK HTVRALQRTV PAAVPAVVFL
310 320 330 340 350
SGGQSEEEAT VNLNAINQLK GKKPWSLTFS YGRALQQSTL KAWGGKEENV
360 370 380 390
DKAQKAFLAR AKANSEATLG GYKGDAQLGE GASESLHVKD YKY
Length:393
Mass (Da):42,906
Last modified:June 28, 2011 - v1
Checksum:i1D6045A5723A1982
GO
Isoform 2 (identifier: F4KGQ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-44: GKSYFRRTFHSSIIQFHPQLSILIWHRRYSIIRTY → D

Note: No experimental confirmation available.Curated
Show »
Length:359
Mass (Da):38,630
Checksum:iA22A64268A7D757B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti23I → V in AAM62481 (Ref. 4) Curated1
Sequence conflicti155T → I in AAM62481 (Ref. 4) Curated1
Sequence conflicti211G → R in AAM62481 (Ref. 4) Curated1
Sequence conflicti287Q → R in AAL32644 (PubMed:14593172).Curated1
Sequence conflicti287Q → R in AAM13358 (PubMed:14593172).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05850310 – 44GKSYF…IIRTY → D in isoform 2. Add BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL162506 Genomic DNA Translation: CAB82934.1
CP002688 Genomic DNA Translation: AED90642.1
CP002688 Genomic DNA Translation: AED90643.1
AY062566 mRNA Translation: AAL32644.1
AY093359 mRNA Translation: AAM13358.1
AY085249 mRNA Translation: AAM62481.1
PIRiT48396
RefSeqiNP_568127.1, NM_120450.3 [F4KGQ0-1]
NP_850759.1, NM_180428.2 [F4KGQ0-2]
UniGeneiAt.27301

Genome annotation databases

EnsemblPlantsiAT5G03690.1; AT5G03690.1; AT5G03690 [F4KGQ0-1]
AT5G03690.2; AT5G03690.2; AT5G03690 [F4KGQ0-2]
GeneIDi831759
GrameneiAT5G03690.1; AT5G03690.1; AT5G03690 [F4KGQ0-1]
AT5G03690.2; AT5G03690.2; AT5G03690 [F4KGQ0-2]
KEGGiath:AT5G03690

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiALFC4_ARATH
AccessioniPrimary (citable) accession number: F4KGQ0
Secondary accession number(s): Q8LET3, Q8W4G8, Q9LZR9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 7, 2016
Last sequence update: June 28, 2011
Last modified: April 25, 2018
This is version 59 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health