Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 71 (29 Sep 2021)
Sequence version 1 (28 Jun 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Protein LNK2

Gene

LNK2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional coactivator necessary for expression of the clock genes PRR5 and TOC1 (PubMed:25012192, PubMed:25848708).

Antagonizes REV8 function in the regulation of anthocyanin accumulation (PubMed:25848001).

Involved in red light input to the clock (PubMed:25012192).

Activates clock-controlled genes with afternoon peak (PubMed:23818596).

Mediates light inhibition of hypocotyl elongation (PubMed:23818596).

Unable to bind to DNA, but recruited to the evening element (EE)-containing region of the PRR5 and TOC1 promoters through its interaction with the DNA binding proteins REV8 and REV4 (PubMed:25012192, PubMed:25848708).

4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator
Biological processBiological rhythms, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein LNK21 Publication
Alternative name(s):
Night light-inducible and clock-regulated 21 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LNK21 Publication
Ordered Locus Names:At3g54500Imported
ORF Names:T14E10.70Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT3G54500

The Arabidopsis Information Resource

More...
TAIRi
locus:2096981, AT3G54500

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

No differences in hypocotyl length when grown in complete darkness, but longer hypocotyls in plants under continuous white or red light (PubMed:23818596). Lengthened circadian cycle (PubMed:25012192).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004360321 – 663Protein LNK2Add BLAST663

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
F4JCX9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
238475 [F4JCX9-1]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in roots, stems, leaves, seedlings, cotyledons, inflorescences and siliques. Highest expression in root tips, young leaves and vasculatur tissues.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Circadian-regulation (PubMed:23818596, PubMed:25012192). Maximum levels of expression in the subjective morning (PubMed:23818596, PubMed:25012192). Up-regulated by a light pulse in the middle of the night via the phytochrome family of red/far-red light photoreceptors (PubMed:23818596, PubMed:25012192). Up-regulated following a temperature upshift during the dark period (PubMed:24690904). Repressed by members of the TOC1/PRR1 family of clock genes (PubMed:23818596).3 Publications

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
F4JCX9, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CCA1, LHY, REV4 and REV8, but not with PRR7 or PRR9.

2 Publications

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
3702.AT3G54500.3

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
F4JCX9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni528 – 549DisorderedSequence analysisAdd BLAST22
Regioni590 – 663DisorderedSequence analysisAdd BLAST74

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi609 – 628Basic and acidic residuesSequence analysisAdd BLAST20
Compositional biasi637 – 653Polar residuesSequence analysisAdd BLAST17

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QS7P, Eukaryota

Identification of Orthologs from Complete Genome Data

More...
OMAi
NNEYSGK

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039928, LNK

The PANTHER Classification System

More...
PANTHERi
PTHR33334, PTHR33334, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: F4JCX9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFDWEEEELT NMIWGDDAET GDHIVPFKVR SEQLNKKEQI EESKTAEQKI
60 70 80 90 100
TGTKIDLHDK NLGSSSSHNV DEGLPQPDFC MSSWPDTSLT NATKVDQDLS
110 120 130 140 150
ATELSKCLAE PVRYDSTRGG AFLLKQSCFT WVRSFQSNHF KSCVLTLFLP
160 170 180 190 200
EKTSELGKGP DIFHSSDESK EQGDFDDYSW ANIGSFDDLD RMFSDGFAAM
210 220 230 240 250
MSLYLVMAVS AVVMSYGHLL KITEFEQQEN QQFPLTGKAN GLSSQSVPSV
260 270 280 290 300
RVTLKADQYR EHKGQPSVED QPYQQNKMMK FSKMPGTSEA RPFQELYGQR
310 320 330 340 350
IPFSNSAGKC VNQLAPPQSS LMAVNLLSES EGSGTSHYSH MPNQYMANSA
360 370 380 390 400
FGNLANPYSS VPVISAVQHP DVRNQLMHPS YNPATATSVN MATDASARPS
410 420 430 440 450
TMTPQEKLEK LRRRQQMQAM LAIQRQQQQF SHQVPVADQS ITQNCLQDIP
460 470 480 490 500
LQLVDKTNLQ GLTAMPSFDP SSSLEQDDSG KFAAAVDNSA EFAVLYRLQD
510 520 530 540 550
VVAKLDMGTR TCIRDSLFRL AGSAAQRHYT SDTSHSNKTS QDDQEVIPRE
560 570 580 590 600
ESRYRYAGMP DTEAVTNPTD RTVAHLLFHR PFDMLAAKRM EGPESPASSK
610 620 630 640 650
MGTEEKGNFP KCSIRETHLT KQKAQKEEGP ADSLALGNAP NSGSSSTVGE
660
RVVEASQGNK RKL
Length:663
Mass (Da):73,593
Last modified:June 28, 2011 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i23D5CFC6793C5518
GO
Isoform 2 (identifier: F4JCX9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: Missing.
     120-150: Missing.
     195-222: DGFAAMMSLYLVMAVSAVVMSYGHLLKI → NDVPIFGDGSLSGGDELWSSSKDVSNSPKSLSSMLDSQDLGLDIR

Show »
Length:569
Mass (Da):62,583
Checksum:iCD49E09BF0BB67C9
GO
Isoform 3 (identifier: F4JCX9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     119-150: Missing.
     195-222: DGFAAMMSLYLVMAVSAVVMSYGHLLKI → NDVPIFGDGSLSGGDELWSSSKDVSNSPKSLSSMLDSQDLGLDIR

Show »
Length:648
Mass (Da):71,656
Checksum:i0EBF9AB7CB05A942
GO
Isoform 4 (identifier: F4JCX9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: Missing.
     195-222: DGFAAMMSLYLVMAVSAVVMSYGHLLKI → NDVPIFGDGSLSGGDELWSSSKDVSNSPKSLSSMLDSQDLGLDIR

Show »
Length:669
Mass (Da):73,877
Checksum:iDA91CEC558F32D27
GO
Isoform 5 (identifier: F4JCX9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     120-150: Missing.
     195-222: DGFAAMMSLYLVMAVSAVVMSYGHLLKI → NDVPIFGDGSLSGGDELWSSSKDVSNSPKSLSSMLDSQDLGLDIR

Show »
Length:649
Mass (Da):71,713
Checksum:i90FB0F067BDC80FA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2H1ZEL2A0A2H1ZEL2_ARATH
Agglutinin-like protein
LNK2 At3g54500
680Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2H1ZEK6A0A2H1ZEK6_ARATH
Agglutinin-like protein
LNK2 At3g54500
453Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0582161 – 80Missing in isoform 2. Add BLAST80
Alternative sequenceiVSP_0582171 – 11Missing in isoform 4. Add BLAST11
Alternative sequenceiVSP_058218119 – 150Missing in isoform 3. Add BLAST32
Alternative sequenceiVSP_058219120 – 150Missing in isoform 2 and isoform 5. Add BLAST31
Alternative sequenceiVSP_058220195 – 222DGFAA…HLLKI → NDVPIFGDGSLSGGDELWSS SKDVSNSPKSLSSMLDSQDL GLDIR in isoform 2, isoform 3, isoform 4 and isoform 5. Add BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL138656 Genomic DNA Translation: CAB77570.1
CP002686 Genomic DNA Translation: AEE79239.1
CP002686 Genomic DNA Translation: AEE79242.1
CP002686 Genomic DNA Translation: ANM64663.1
CP002686 Genomic DNA Translation: ANM64664.1
CP002686 Genomic DNA Translation: ANM64665.1
CP002686 Genomic DNA Translation: ANM64666.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T47609

NCBI Reference Sequences

More...
RefSeqi
NP_001190089.1, NM_001203160.1 [F4JCX9-1]
NP_001326676.1, NM_001339675.1 [F4JCX9-2]
NP_001326677.1, NM_001339676.1 [F4JCX9-5]
NP_001326678.1, NM_001339674.1 [F4JCX9-5]
NP_191014.2, NM_115307.5 [F4JCX9-3]
NP_974432.2, NM_202703.3 [F4JCX9-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT3G54500.1; AT3G54500.1; AT3G54500 [F4JCX9-3]
AT3G54500.4; AT3G54500.4; AT3G54500 [F4JCX9-1]
AT3G54500.5; AT3G54500.5; AT3G54500 [F4JCX9-5]
AT3G54500.6; AT3G54500.6; AT3G54500 [F4JCX9-2]
AT3G54500.7; AT3G54500.7; AT3G54500 [F4JCX9-5]
AT3G54500.8; AT3G54500.8; AT3G54500 [F4JCX9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
824615

Gramene; a comparative resource for plants

More...
Gramenei
AT3G54500.1; AT3G54500.1; AT3G54500 [F4JCX9-3]
AT3G54500.4; AT3G54500.4; AT3G54500 [F4JCX9-1]
AT3G54500.5; AT3G54500.5; AT3G54500 [F4JCX9-5]
AT3G54500.6; AT3G54500.6; AT3G54500 [F4JCX9-2]
AT3G54500.7; AT3G54500.7; AT3G54500 [F4JCX9-5]
AT3G54500.8; AT3G54500.8; AT3G54500 [F4JCX9-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT3G54500

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL138656 Genomic DNA Translation: CAB77570.1
CP002686 Genomic DNA Translation: AEE79239.1
CP002686 Genomic DNA Translation: AEE79242.1
CP002686 Genomic DNA Translation: ANM64663.1
CP002686 Genomic DNA Translation: ANM64664.1
CP002686 Genomic DNA Translation: ANM64665.1
CP002686 Genomic DNA Translation: ANM64666.1
PIRiT47609
RefSeqiNP_001190089.1, NM_001203160.1 [F4JCX9-1]
NP_001326676.1, NM_001339675.1 [F4JCX9-2]
NP_001326677.1, NM_001339676.1 [F4JCX9-5]
NP_001326678.1, NM_001339674.1 [F4JCX9-5]
NP_191014.2, NM_115307.5 [F4JCX9-3]
NP_974432.2, NM_202703.3 [F4JCX9-2]

3D structure databases

SMRiF4JCX9
ModBaseiSearch...

Protein-protein interaction databases

STRINGi3702.AT3G54500.3

Proteomic databases

PRIDEiF4JCX9
ProteomicsDBi238475 [F4JCX9-1]

Genome annotation databases

EnsemblPlantsiAT3G54500.1; AT3G54500.1; AT3G54500 [F4JCX9-3]
AT3G54500.4; AT3G54500.4; AT3G54500 [F4JCX9-1]
AT3G54500.5; AT3G54500.5; AT3G54500 [F4JCX9-5]
AT3G54500.6; AT3G54500.6; AT3G54500 [F4JCX9-2]
AT3G54500.7; AT3G54500.7; AT3G54500 [F4JCX9-5]
AT3G54500.8; AT3G54500.8; AT3G54500 [F4JCX9-2]
GeneIDi824615
GrameneiAT3G54500.1; AT3G54500.1; AT3G54500 [F4JCX9-3]
AT3G54500.4; AT3G54500.4; AT3G54500 [F4JCX9-1]
AT3G54500.5; AT3G54500.5; AT3G54500 [F4JCX9-5]
AT3G54500.6; AT3G54500.6; AT3G54500 [F4JCX9-2]
AT3G54500.7; AT3G54500.7; AT3G54500 [F4JCX9-5]
AT3G54500.8; AT3G54500.8; AT3G54500 [F4JCX9-2]
KEGGiath:AT3G54500

Organism-specific databases

AraportiAT3G54500
TAIRilocus:2096981, AT3G54500

Phylogenomic databases

eggNOGiENOG502QS7P, Eukaryota
OMAiNNEYSGK

Miscellaneous databases

Protein Ontology

More...
PROi
PR:F4JCX9

Gene expression databases

ExpressionAtlasiF4JCX9, baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR039928, LNK
PANTHERiPTHR33334, PTHR33334, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLNK2_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: F4JCX9
Secondary accession number(s): A0A1I9LQ06
, A0A1I9LQ07, F4JCX8, F4JCY0, F4JCY1, Q9M1H7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2016
Last sequence update: June 28, 2011
Last modified: September 29, 2021
This is version 71 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again