Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 62 (31 Jul 2019)
Sequence version 1 (28 Jun 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

BEACH domain-containing protein C2

Gene

BCHC2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
BEACH domain-containing protein C21 Publication
Alternative name(s):
BEACH-domain homolog C2Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BCHC21 Publication
Ordered Locus Names:At2g45540Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT2G45540

The Arabidopsis Information Resource

More...
TAIRi
locus:2043679 AT2G45540

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004340361 – 3001BEACH domain-containing protein C2Add BLAST3001

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei48PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
F4IG73

PRoteomics IDEntifications database

More...
PRIDEi
F4IG73

Protein Mass spectra EXtraction

More...
ProMEXi
F4IG73

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
F4IG73

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
F4IG73 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
F4IG73 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
3702.AT2G45540.2

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
F4IG73

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2151 – 2260BEACH-type PHPROSITE-ProRule annotationAdd BLAST110
Domaini2275 – 2564BEACHPROSITE-ProRule annotationAdd BLAST290
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati2679 – 2718WD 1Sequence analysisAdd BLAST40
Repeati2721 – 2760WD 2Sequence analysisAdd BLAST40
Repeati2802 – 2841WD 3Sequence analysisAdd BLAST40
Repeati2842 – 2881WD 4Sequence analysisAdd BLAST40
Repeati2953 – 2992WD 5Sequence analysisAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi407 – 438Ala-richPROSITE-ProRule annotationAdd BLAST32
Compositional biasi555 – 558Poly-ArgSequence analysis4
Compositional biasi1384 – 1420Ala-richPROSITE-ProRule annotationAdd BLAST37
Compositional biasi1473 – 1506Ser-richPROSITE-ProRule annotationAdd BLAST34
Compositional biasi1563 – 1568Poly-GlySequence analysis6
Compositional biasi1606 – 1623Gly-richPROSITE-ProRule annotationAdd BLAST18
Compositional biasi1777 – 1821Ala-richPROSITE-ProRule annotationAdd BLAST45
Compositional biasi1822 – 1827Poly-ProSequence analysis6
Compositional biasi1869 – 1903Ala-richPROSITE-ProRule annotationAdd BLAST35

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1787 Eukaryota
ENOG410XNQC LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000083180

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
F4IG73

Identification of Orthologs from Complete Genome Data

More...
OMAi
NMPINES

Database of Orthologous Groups

More...
OrthoDBi
101142at2759

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06071 Beach, 1 hit
cd01201 PH_BEACH, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1540.10, 1 hit
2.130.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000409 BEACH_dom
IPR036372 BEACH_dom_sf
IPR013320 ConA-like_dom_sf
IPR031570 DUF4704
IPR023362 PH-BEACH_dom
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02138 Beach, 1 hit
PF15787 DUF4704, 1 hit
PF14844 PH_BEACH, 1 hit
PF00400 WD40, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01026 Beach, 1 hit
SM00320 WD40, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 1 hit
SSF50978 SSF50978, 1 hit
SSF81837 SSF81837, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50197 BEACH, 1 hit
PS51783 PH_BEACH, 1 hit
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: F4IG73-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEDDDERKLP EADIANPLHN RIEAFDTTLQ GISSADRAFK DDDFEQVSLG
60 70 80 90 100
DQEKAANESQ GDLQEPGSFS NSDHGRSSFG GTEVVTYQLS GTQEMYDLMP
110 120 130 140 150
MDDVQSDRLS SPGPEREAAY SMQQSLSETS LDSVHHPESG YSPVHSPQKP
160 170 180 190 200
KPKATVPNVS PELLHLVDSA IMGKPESLDK LKNVVCGIEN FGCGEESEAT
210 220 230 240 250
AFLVVDSLIA TMGGVESFEE DEDSNPPSVM LNSRAAIVSG ELIPWLPGLG
260 270 280 290 300
DNVNFMSPRT RMVRGLLVIL RSCTRNRAMC STAGLLGVLL RSVEAIISKD
310 320 330 340 350
VDMKWNAAAI LLLCIQHLAG HSLSVDDLHR WLQVIKAAIT TAWSSPLMLA
360 370 380 390 400
LEKAMSGKES RGPACTFEFD GESSGLLGPG ESRWPFTNGY AFATWIYIES
410 420 430 440 450
FADTLNAATA AAAIAAAAAA KSGKTSAMSA AAAASALAGE GTAHMPRLFS
460 470 480 490 500
FLSADNQGIE AYFHAQFLVV ESGSGKGRKS SLHFTHAFKP QCWYFIGLEH
510 520 530 540 550
SCKQGLLGKA ESELRLYIDG SLYESRPFDF PRISKPLSFC CIGTNPPPTM
560 570 580 590 600
AGLQRRRRQC PLFAEMGPVY IFKEPIGPER MARLASRGGD VLPCFGNGAG
610 620 630 640 650
LPWLATNDYV RNKAEESSIL DADIGGYTHL LYHPCLLSGR FCPDASLSGA
660 670 680 690 700
AGTLRRPAEV LGQVHVATRM KPVESFWALA YGGPMSLLPL TVSSVHKDSL
710 720 730 740 750
EPCLGNLPLS LSTVTLAAPV FRIMSVAIQH PGNNEELCRT QGPEILARIL
760 770 780 790 800
SYLLHSLASL DRKHDGVGEE ELVAAIVSLC QSQKINHVLK VQLFRTLLLD
810 820 830 840 850
LKIWSLCNYG LQKKLLSSLQ DMVFTEATAM RDAEAIQLLL DGCRRCYWMI
860 870 880 890 900
SEKDSETTFP LDGNTRQMGE LNALIDELLV IIELLMGAAS PSLAADDLRR
910 920 930 940 950
LLGFIIDSPQ PNQVHCKFNA NASAVCSLLA LLLIKLVPLF RSQIMYMNSR
960 970 980 990 1000
KPSYNGLHGE MWVISRENGL TDCTRLCWLV VQPNAARAQM FAEVFITSGG
1010 1020 1030 1040 1050
IETLLVLLQR EAKTGEDNVL AMGRSGKRSS TDPSEKSPYN ESGSVKQLDS
1060 1070 1080 1090 1100
NPHDNEIGFD LPGPDGNSVE DDNVGSLNVP ESVRQEKEHG STPVVCDSDS
1110 1120 1130 1140 1150
VSISNSINTE RLSAEIGGIS LSISADSARN NVYNVDNSDA VVVGIIRLIG
1160 1170 1180 1190 1200
ALISSGHLTF DFDARSDVTS NILGSGLHEN GGTMFDDKVA LLLFALLKAF
1210 1220 1230 1240 1250
QAAPNRLMTD NVYTTLLGAS INASSTEDGL NFYDSGHRFE HSQLLLVLLR
1260 1270 1280 1290 1300
SLPSASKALQ SRALQDLLFL ACSHPENRSS LTTMEEWPEW ILEILISNYE
1310 1320 1330 1340 1350
KDAGKQSASV GSCEVEDMIH NFLIIMLEHS MRQKDGWKDI EATIHCAEWL
1360 1370 1380 1390 1400
SIVGGSSTGE QRIRREESLP IFKRRLFGGL LDFAARELQA QTQVIAAAAA
1410 1420 1430 1440 1450
GVAAEGLAPK DAKAGAENAA QLSVFLVENA IVILMLVEDH LRSQSKQTCA
1460 1470 1480 1490 1500
TNAVASPSPL KKRTSTLTAI GESSEISSSR ASLSSDSGKV PLDILASMAD
1510 1520 1530 1540 1550
SSGQISAVAM ERLTAASAAE PYESVSCAFV SYGSCAMDLA EGWKYRSRLW
1560 1570 1580 1590 1600
YGVGLPSKPS SLGGGGSGSD SWKSTLEKDA HGNWIELPLV KKSVSMLQAL
1610 1620 1630 1640 1650
LLDESGLGGG LGIGGGSGTG MGGMTALYQL LDSDQPFLCM LRMVLLSMRE
1660 1670 1680 1690 1700
EDYGEDNMLM RNLSSERSSG NSVTLDSGSQ MSMRQSRSAL LWSVLSPIIN
1710 1720 1730 1740 1750
MPISDSKRQR VLVTACVLYS EVWHAISRDR RPLRKQYIEA IVPPFIAVLR
1760 1770 1780 1790 1800
RWRPLLAGIH ELATADGMNP LVVDDRALAA DALPVEGALS MVTPEWAAAF
1810 1820 1830 1840 1850
ASPPAAMSLA MIAAGAAGWE APPPPTPSHL RRDSSMLERK TAKLQTFSSF
1860 1870 1880 1890 1900
QKPLEPPNNN APPRPRDKAA AKAAALAAAR DLERNAKIGS GRGLSAVAMA
1910 1920 1930 1940 1950
TSAQRRNIGD MERLQRWNTS EAMGVAWMEC LQPVDTKSVY GKDFNALSYK
1960 1970 1980 1990 2000
FIAVLVASFA LARNMQRSEI DRRMQDDIIA ANRLCLGSRA WRKLIRYLAE
2010 2020 2030 2040 2050
MRCFFGPFGD GICSPERVFW KLDSMESFSR MRQSIRRNYS GTDHHGAAAD
2060 2070 2080 2090 2100
YDDQTETKSD NGSKGSQSNP PVVAAEVILM EIAYEEDEHG EGDQLDVKGN
2110 2120 2130 2140 2150
AEEHKRDEGR ISGSHEHASR TSAGNSDPRT SNDLEMVRDS SVVAPGFVPS
2160 2170 2180 2190 2200
ELDERILLEL PTSMVRPLRV VKGTFQITTR RINFIVDNRE SQNLADHSDE
2210 2220 2230 2240 2250
SQSGDQEKDR SWPMSSLHQI YSRRYLLRRS ALELFMVDRS NFFFDFGNTE
2260 2270 2280 2290 2300
GRRNAYRAIV QARPPHLNNI YLATQRPEQL LRRTQLMERW ARWEISNFEY
2310 2320 2330 2340 2350
LMQLNTLAGR SYNDITQYPV FPWIISDNSS ESLDLSNPST FRDLSKPIGA
2360 2370 2380 2390 2400
LNPERLKKFQ ERYSSFEDPV IPKFHYGSHY SSAGAVLYYL ARVEPFTTLS
2410 2420 2430 2440 2450
IQLQGGKFDH ADRMFSDFPG TWNGVLEDMS DVKELVPELF YLPEVLTNEN
2460 2470 2480 2490 2500
SIDFGTTQLG EKLDAVKLPP WAKNPVDFVH KQRRALESEH VSAHLHEWID
2510 2520 2530 2540 2550
LIFGYKQRGK EAIMANNVFF YITYEGTVDI DKITDPVQQR ATQDQIAYFG
2560 2570 2580 2590 2600
QTPSQLLTVP HMKRMPLKDV LHMQTIFRNP KEIKPYTVQT PERCNLPASA
2610 2620 2630 2640 2650
IQASSDSVVI VDMNVPAARV AQHKWQPNTP DGQGTPFLFH HGKATTTSTS
2660 2670 2680 2690 2700
GSLMRMFKGP ASSGTGDWQF PQAQAFASSG IRSSSVIAIT SDGEIITGGH
2710 2720 2730 2740 2750
ADNSIKLVSS DGAKTLETAF GHCAPVTCLA LSPDNNFLVT GSRDSTVLLW
2760 2770 2780 2790 2800
RIHKAFTSRT SVSEPSTGSG APSSTSNTNL ANTLANKGKK CRLEGPIQVL
2810 2820 2830 2840 2850
RGHRRELVCC CVSSDQGVVV SSSESSDVLL HSIRKGRLIR RLVGVKADSL
2860 2870 2880 2890 2900
CISSDGVIMA WSSSEGSISV FTINGVLIAK AKFPLFCSVG CMEISMDGQN
2910 2920 2930 2940 2950
ALIGMNSCSN SDYSSSNDTS KDSKEIERLD VPSPSICFLN LYTLQVFHVL
2960 2970 2980 2990 3000
KLGQGQDITA LALNVDNTNL LVSTEDKQLI IFTDPALSLK VVDQMLKLGW

E
Length:3,001
Mass (Da):328,092
Last modified:June 28, 2011 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC47C1279134ADBEC
GO
Isoform 2 (identifier: F4IG73-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     915-978: HCKFNANASAVCSLLALLLIKLVPLFRSQIMYMNSRKPSYNGLHGEMWVISRENGLTDCTRLCW → ARVLHLMYR

Note: No experimental confirmation available. Derived from EST data.Curated
Show »
Length:2,946
Mass (Da):321,935
Checksum:iB162CFBDEB5D3372
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_057891915 – 978HCKFN…TRLCW → ARVLHLMYR in isoform 2. Add BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC003680 Genomic DNA Translation: AAC06163.1
CP002685 Genomic DNA Translation: AEC10567.1
CP002685 Genomic DNA Translation: AEC10568.1
CP002685 Genomic DNA Translation: ANM63206.1
CP002685 Genomic DNA Translation: ANM63207.1
CP002685 Genomic DNA Translation: ANM63208.1
CP002685 Genomic DNA Translation: ANM63209.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T00867

NCBI Reference Sequences

More...
RefSeqi
NP_001189752.1, NM_001202823.2 [F4IG73-1]
NP_001318429.1, NM_001337139.1 [F4IG73-2]
NP_001325311.1, NM_001337140.1 [F4IG73-2]
NP_001325312.1, NM_001337142.1 [F4IG73-2]
NP_001325313.1, NM_001337141.1 [F4IG73-2]
NP_182078.1, NM_130116.4 [F4IG73-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT2G45540.1; AT2G45540.1; AT2G45540 [F4IG73-2]
AT2G45540.2; AT2G45540.2; AT2G45540 [F4IG73-1]
AT2G45540.3; AT2G45540.3; AT2G45540 [F4IG73-2]
AT2G45540.4; AT2G45540.4; AT2G45540 [F4IG73-2]
AT2G45540.5; AT2G45540.5; AT2G45540 [F4IG73-2]
AT2G45540.6; AT2G45540.6; AT2G45540 [F4IG73-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
819162

Gramene; a comparative resource for plants

More...
Gramenei
AT2G45540.1; AT2G45540.1; AT2G45540 [F4IG73-2]
AT2G45540.2; AT2G45540.2; AT2G45540 [F4IG73-1]
AT2G45540.3; AT2G45540.3; AT2G45540 [F4IG73-2]
AT2G45540.4; AT2G45540.4; AT2G45540 [F4IG73-2]
AT2G45540.5; AT2G45540.5; AT2G45540 [F4IG73-2]
AT2G45540.6; AT2G45540.6; AT2G45540 [F4IG73-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT2G45540

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC003680 Genomic DNA Translation: AAC06163.1
CP002685 Genomic DNA Translation: AEC10567.1
CP002685 Genomic DNA Translation: AEC10568.1
CP002685 Genomic DNA Translation: ANM63206.1
CP002685 Genomic DNA Translation: ANM63207.1
CP002685 Genomic DNA Translation: ANM63208.1
CP002685 Genomic DNA Translation: ANM63209.1
PIRiT00867
RefSeqiNP_001189752.1, NM_001202823.2 [F4IG73-1]
NP_001318429.1, NM_001337139.1 [F4IG73-2]
NP_001325311.1, NM_001337140.1 [F4IG73-2]
NP_001325312.1, NM_001337142.1 [F4IG73-2]
NP_001325313.1, NM_001337141.1 [F4IG73-2]
NP_182078.1, NM_130116.4 [F4IG73-2]

3D structure databases

SMRiF4IG73
ModBaseiSearch...

Protein-protein interaction databases

STRINGi3702.AT2G45540.2

PTM databases

iPTMnetiF4IG73

Proteomic databases

PaxDbiF4IG73
PRIDEiF4IG73
ProMEXiF4IG73

Genome annotation databases

EnsemblPlantsiAT2G45540.1; AT2G45540.1; AT2G45540 [F4IG73-2]
AT2G45540.2; AT2G45540.2; AT2G45540 [F4IG73-1]
AT2G45540.3; AT2G45540.3; AT2G45540 [F4IG73-2]
AT2G45540.4; AT2G45540.4; AT2G45540 [F4IG73-2]
AT2G45540.5; AT2G45540.5; AT2G45540 [F4IG73-2]
AT2G45540.6; AT2G45540.6; AT2G45540 [F4IG73-2]
GeneIDi819162
GrameneiAT2G45540.1; AT2G45540.1; AT2G45540 [F4IG73-2]
AT2G45540.2; AT2G45540.2; AT2G45540 [F4IG73-1]
AT2G45540.3; AT2G45540.3; AT2G45540 [F4IG73-2]
AT2G45540.4; AT2G45540.4; AT2G45540 [F4IG73-2]
AT2G45540.5; AT2G45540.5; AT2G45540 [F4IG73-2]
AT2G45540.6; AT2G45540.6; AT2G45540 [F4IG73-2]
KEGGiath:AT2G45540

Organism-specific databases

AraportiAT2G45540
TAIRilocus:2043679 AT2G45540

Phylogenomic databases

eggNOGiKOG1787 Eukaryota
ENOG410XNQC LUCA
HOGENOMiHOG000083180
InParanoidiF4IG73
OMAiNMPINES
OrthoDBi101142at2759

Miscellaneous databases

Protein Ontology

More...
PROi
PR:F4IG73

Gene expression databases

ExpressionAtlasiF4IG73 baseline and differential
GenevisibleiF4IG73 AT

Family and domain databases

CDDicd06071 Beach, 1 hit
cd01201 PH_BEACH, 1 hit
Gene3Di1.10.1540.10, 1 hit
2.130.10.10, 2 hits
InterProiView protein in InterPro
IPR000409 BEACH_dom
IPR036372 BEACH_dom_sf
IPR013320 ConA-like_dom_sf
IPR031570 DUF4704
IPR023362 PH-BEACH_dom
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF02138 Beach, 1 hit
PF15787 DUF4704, 1 hit
PF14844 PH_BEACH, 1 hit
PF00400 WD40, 1 hit
SMARTiView protein in SMART
SM01026 Beach, 1 hit
SM00320 WD40, 4 hits
SUPFAMiSSF49899 SSF49899, 1 hit
SSF50978 SSF50978, 1 hit
SSF81837 SSF81837, 1 hit
PROSITEiView protein in PROSITE
PS50197 BEACH, 1 hit
PS51783 PH_BEACH, 1 hit
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBCHC2_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: F4IG73
Secondary accession number(s): O64634
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 14, 2015
Last sequence update: June 28, 2011
Last modified: July 31, 2019
This is version 62 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again