Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 55 (22 Apr 2020)
Sequence version 1 (28 Jun 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein TPX2

Gene

TPX2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulates prospindle assembly during late prophase and at the onset of mitosis, before nuclear envelope breakdown (NEB). Is exported from the nucleus shortly before NEB and organized into two polar crescents. After NEB, is progressively associated with the forming spindle. Probably mediates AUR1 activation and localization to spindle microtubules. Has a microtubule binding capability and is able to trigger microtubule assembly induced by RanGTP in a heterologous system. Not involved in phragmoplast assembly, nuclear envelope reformation, and cortical microtubule assembly at the onset of G1 (PubMed:18941054). Involved in the formation of specific nuclear and perinuclear microtubular arrays in the nuclei of acentrosomal plant cells. Fungi and plants have acentrosomal microtubule arrays because they lack centrosomes. They use other microtubule organizing center (MTOC) structures to organize their microtubules. May function through interaction with importin (PubMed:24006426).2 Publications

Miscellaneous

TPX2 over-expressing cells display formation of nuclear and perinuclear microtubular arrays which are not specific for the transition to mitosis and occur independently of AUR1 kinase.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Mitosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein TPX2
Short name:
AtTPX2
Alternative name(s):
Targeting protein for XKLP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TPX2
Ordered Locus Names:At1g03780
ORF Names:F11M21.29
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT1G03780

The Arabidopsis Information Resource

More...
TAIRi
locus:2024132 AT1G03780

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Lethal when homozygous.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi231 – 232KR → NG: Loss of nuclear targeting. 1 Publication2
Mutagenesisi500L → S: Loss of export from the nucleus; when associated with H-506. 1 Publication1
Mutagenesisi506L → H: Loss of export from the nucleus; when associated with S-500. 1 Publication1
Mutagenesisi673 – 674KR → NG: Loss of nuclear targeting. 1 Publication2
Mutagenesisi733 – 734KR → NG: No effect on nuclear targeting. 1 Publication2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004207031 – 790Protein TPX2Add BLAST790

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
F4I2H7

PRoteomics IDEntifications database

More...
PRIDEi
F4I2H7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
F4I2H7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
F4I2H7 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with AUR1.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
24377, 1 interactor

STRING: functional protein association networks

More...
STRINGi
3702.AT1G03780.3

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
F4I2H7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili588 – 619Sequence analysisAdd BLAST32
Coiled coili656 – 698Sequence analysisAdd BLAST43

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi586 – 688Glu-richAdd BLAST103

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminal part of the protein is required for the interaction with AUR1. Two regions (220-463 and 684-758) seem involved in the targeting to the microtubule cytoskeleton.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TPX2 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410JR1W Eukaryota
ENOG410ZTMD LUCA

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
F4I2H7

KEGG Orthology (KO)

More...
KOi
K16812

Identification of Orthologs from Complete Genome Data

More...
OMAi
FSFEARN

Database of Orthologous Groups

More...
OrthoDBi
1390734at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027329 TPX2_C
IPR027330 TPX2_central_dom
IPR009675 TPX2_fam

The PANTHER Classification System

More...
PANTHERi
PTHR14326 PTHR14326, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06886 TPX2, 1 hit
PF12214 TPX2_importin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: F4I2H7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEATAEESVS TLVTTMVDET YEFLAPRWFD FVNGETEDES RRAELWFQSA
60 70 80 90 100
LSCAPSPSVP RIKARRSFKV EAMCNFNEAE EETLKDKEPL EPVVPIVSLQ
110 120 130 140 150
SQPSQAKKAE VAPSKASTVK PSRISSKDAE VNNKTVDASD PTTEPIEDKE
160 170 180 190 200
NIAPACTPKP PMQFSLGAKS VDLKKQQTAR KIASLLKNPS TLRPKNQSQA
210 220 230 240 250
KGSHQKSVKG ETNLNNIAST TNLIQENQAI KRQKLDDGKS RQILNPKPAT
260 270 280 290 300
LLHKTRNGLV NTGFNLCPSV TKHTPKENRK VYVREQIAPF VSTAELMKKF
310 320 330 340 350
QTSTRDLFVQ NRPKLTLTRP KEPEFVTSQR ARPLRVKSSA ELEEEMLAKI
360 370 380 390 400
PKFKARPVNK KILAAPALPA PQRSTPHLPE FQEFHLQTMA RANQHAETSS
410 420 430 440 450
IASTEVSKQH NDQKHHLTEP KSPVLQTMLR ARPTIAKTTA ELEQEELEKA
460 470 480 490 500
PKFKAKPLNK KIFESKGEMG IFCNTKKHIT IPQEFHFATD ERISRPESVL
510 520 530 540 550
DIFDKLSLNS ESCHEKPLPR NTAPNPFNLK TEERGAEKEK KFYMELMYKK
560 570 580 590 600
LGDVKARVPK ANPYPYTTDY PVVPPKPEPK QCTQPEPFQL ESLVRHEEEM
610 620 630 640 650
RREREERRRM ETEEAQKRLF KAQPVIKEDP IPVPEKVRMP LTEIQEFNLH
660 670 680 690 700
VEHRAVERAD FDHKIKEKEN QYKRYREESE AAKMVEEERA LKQMRKTMVP
710 720 730 740 750
HARPVPNFNK PFLPQKSNKG TTKAKSPNLR VIKRTERRTM MARPTISAAT
760 770 780 790
SASAVHCLMY PGSSFNKLKK KTVLTNIVHC LMYPDSSLLN
Length:790
Mass (Da):90,083
Last modified:June 28, 2011 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i11BDAD2288B217DA
GO
Isoform 2 (identifier: F4I2H7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     755-758: VHCL → GQMR
     759-790: Missing.

Show »
Length:758
Mass (Da):86,478
Checksum:i471D168D31546809
GO
Isoform 3 (identifier: F4I2H7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     362-382: Missing.
     506-532: Missing.
     572-572: V → VKREMVLINLTCSNSQ
     664-664: K → KVSILFSHFSKQKNASITSEIDESILFWNQ
     686-691: EEERAL → CNISNA
     692-790: Missing.

Show »
Length:687
Mass (Da):78,650
Checksum:i249E5A360150CC49
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD10690 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044609362 – 382Missing in isoform 3. CuratedAdd BLAST21
Alternative sequenceiVSP_044610506 – 532Missing in isoform 3. CuratedAdd BLAST27
Alternative sequenceiVSP_044611572V → VKREMVLINLTCSNSQ in isoform 3. Curated1
Alternative sequenceiVSP_044612664K → KVSILFSHFSKQKNASITSE IDESILFWNQ in isoform 3. Curated1
Alternative sequenceiVSP_044613686 – 691EEERAL → CNISNA in isoform 3. Curated6
Alternative sequenceiVSP_044614692 – 790Missing in isoform 3. CuratedAdd BLAST99
Alternative sequenceiVSP_044615755 – 758VHCL → GQMR in isoform 2. 1 Publication4
Alternative sequenceiVSP_044616759 – 790Missing in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC003027 Genomic DNA Translation: AAD10690.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE27611.1
CP002684 Genomic DNA Translation: AEE27612.1
CP002684 Genomic DNA Translation: AEE27613.1
AK221598 mRNA Translation: BAD95139.1

Protein sequence database of the Protein Information Resource

More...
PIRi
C86168

NCBI Reference Sequences

More...
RefSeqi
NP_001184902.1, NM_001197973.1 [F4I2H7-1]
NP_171874.3, NM_100257.3 [F4I2H7-3]
NP_973754.2, NM_202025.3 [F4I2H7-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT1G03780.1; AT1G03780.1; AT1G03780 [F4I2H7-3]
AT1G03780.2; AT1G03780.2; AT1G03780 [F4I2H7-2]
AT1G03780.3; AT1G03780.3; AT1G03780 [F4I2H7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
839140

Gramene; a comparative resource for plants

More...
Gramenei
AT1G03780.1; AT1G03780.1; AT1G03780 [F4I2H7-3]
AT1G03780.2; AT1G03780.2; AT1G03780 [F4I2H7-2]
AT1G03780.3; AT1G03780.3; AT1G03780 [F4I2H7-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT1G03780

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC003027 Genomic DNA Translation: AAD10690.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE27611.1
CP002684 Genomic DNA Translation: AEE27612.1
CP002684 Genomic DNA Translation: AEE27613.1
AK221598 mRNA Translation: BAD95139.1
PIRiC86168
RefSeqiNP_001184902.1, NM_001197973.1 [F4I2H7-1]
NP_171874.3, NM_100257.3 [F4I2H7-3]
NP_973754.2, NM_202025.3 [F4I2H7-2]

3D structure databases

SMRiF4I2H7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi24377, 1 interactor
STRINGi3702.AT1G03780.3

Proteomic databases

PaxDbiF4I2H7
PRIDEiF4I2H7

Genome annotation databases

EnsemblPlantsiAT1G03780.1; AT1G03780.1; AT1G03780 [F4I2H7-3]
AT1G03780.2; AT1G03780.2; AT1G03780 [F4I2H7-2]
AT1G03780.3; AT1G03780.3; AT1G03780 [F4I2H7-1]
GeneIDi839140
GrameneiAT1G03780.1; AT1G03780.1; AT1G03780 [F4I2H7-3]
AT1G03780.2; AT1G03780.2; AT1G03780 [F4I2H7-2]
AT1G03780.3; AT1G03780.3; AT1G03780 [F4I2H7-1]
KEGGiath:AT1G03780

Organism-specific databases

AraportiAT1G03780
TAIRilocus:2024132 AT1G03780

Phylogenomic databases

eggNOGiENOG410JR1W Eukaryota
ENOG410ZTMD LUCA
InParanoidiF4I2H7
KOiK16812
OMAiFSFEARN
OrthoDBi1390734at2759

Miscellaneous databases

Protein Ontology

More...
PROi
PR:F4I2H7

Gene expression databases

ExpressionAtlasiF4I2H7 baseline and differential
GenevisibleiF4I2H7 AT

Family and domain databases

InterProiView protein in InterPro
IPR027329 TPX2_C
IPR027330 TPX2_central_dom
IPR009675 TPX2_fam
PANTHERiPTHR14326 PTHR14326, 1 hit
PfamiView protein in Pfam
PF06886 TPX2, 1 hit
PF12214 TPX2_importin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTPX2_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: F4I2H7
Secondary accession number(s): F4I2H9
, Q3EDJ2, Q56XS5, Q9ZWA0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 9, 2013
Last sequence update: June 28, 2011
Last modified: April 22, 2020
This is version 55 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again